y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.012G151700.1
FamilyGT24
Protein PropertiesLength: 1674 Molecular Weight: 189013 Isoelectric Point: 5.9716
ChromosomeChromosome/Scaffold: 12 Start: 32540759 End: 32556725
DescriptionUDP-glucose:glycoprotein glucosyltransferases;transferases, transferring hexosyl groups;transferases, transferring glycosyl groups
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT24133314330
  INIFSIASGHLYERFLKIMILSVLKNTHRPVKFWFIKNYLSPQFKDVIPHMAQEYGFDYELVTYKWPTWLHKQTEKQRIIWAYKILFLDVIFPISLEKVL
  Y
GT24146116120
  VQVIFVDADQVVRADMGDLYDMDIKGRPLAYTPFCDNNKDMDGYRFWRQGFWREHLRGRPYHISALYVVDLVKFRETAAGDNLRVFYESLSKDPNSLANL
  DQDLPNYAQHTVPIFSLPQEWLWCESWCGNATKSRAKTIDLCNNPMTKEPKL
Full Sequence
Protein Sequence     Length: 1674     Download
MDTCFRSRFC ILILLTCLLI SGFTFVGAQN RRPKNVQVAI RAKWSGTPLL LEAGELLSKE    60
SKNLFWEFID DWLLVGKTDD DSHSAKDCLV KILKHGSSLL SEQLASLFEF SLTLRSASPR    120
LVLYRQLAEE SLSSFPLSDD SYSHNASGVD DSEAVVTKKL DPLLVGVNPK SPRGKCCWVD    180
VGEELFFEVA ELQSWLLGPN EVNGDSFQQP ELYEFDHIHF DSNIASPVAI LYGALGTECF    240
REFHVTLVQA AKEGKVKYVV RPVLPSGCEG EVGQCGAVGA RDSLNLGGYG VELALKNMEY    300
KAMDDSTVKK GVTLEDPRTE DLSQEVRGFI FSKILERKPD LTSEIMAFRD YLLSSTISDT    360
LDVWELKDLG HQTAQRIVQA SDPLQSMQEI NQNFPSVVSS LSRMKLNDSV KDEIIANQRM    420
IPPGKSLMAL NGALINIEDI DLYLLIDLVH QELSLADQFS KLKLPRSTIR KLLSTMTPPE    480
SDAFRVDFRS DHVHYLNNLE EDAMYRRWRS NINDILMPVF PGQLRYIRKN LFHAVYVLDP    540
STVSGLQSID MITSFYENSF PMRFGVILYS TQFIKKIEQS GGELHSSEHD GELEDDKSSL    600
IIRLFIYIKE NHGIQSAFQF LSNINRLRTE SADSTDEALE MHHIEGAFVE TLLPKAKSPP    660
QEILLKLEKE QSFKELSQES SLFVFKLGVN KLQCCLLMNG LVFDSSEDAL INAMNDELPR    720
IQEQVYYGKI NSHTNVLDKF LSENGVSRYN PQIIAGGKVK PGFVSLASPA LGGESVLNEI    780
NYLHSPGTVD DVKPVTHLLA VDVTSRKGIK LLREAIRYLI QGSKNARVGV LFTAGQDANL    840
SNILLVKTFE ITAASYSHKK KVLEFLDQVC SFYEHKYILR SPAAAESTQA FINKVYELAE    900
ANELPSKTYK SSLSEAYNLK LIEHLNKVAQ YLYRQFGISS GVNAVITNGR ITSLDAGVFL    960
GDDLHLLESV EFNHRIKHIV EIVEEVSWHG IDPDMLTSKY VSDIIMLISS SMATRDRSAE    1020
SARFEILNAQ YSAVILNNEN SSIHIDAVVD PLSPSGQKLS SLLRVLAKYV HPSMRIVLNP    1080
MSSLVDLPLK NYYRYVIPTM EDFSSTDYTV NGPKAFFANM PLSKTLTMNL DVPEPWLVEP    1140
VIAVHDLDNI LLENLGDIRT LQAVFELEAL VLTGHCAEKD RDPPRGLQLI LGTKNTPHLV    1200
DTIVMANLGY WQMKVSPGVW YLQLAPGRSS ELYLFRDGGD YGNQEKSLSK RITINDLRGK    1260
VVHLEVVKKK GKEQEKLLIS SDDDKHSKEK GHNGWNSNLL KWASGFIGGS EKSKKSSDSS    1320
VDHGKGGRHG KTINIFSIAS GHLYERFLKI MILSVLKNTH RPVKFWFIKN YLSPQFKDVI    1380
PHMAQEYGFD YELVTYKWPT WLHKQTEKQR IIWAYKILFL DVIFPISLEK VLYPFCFPQF    1440
LLDNCTLLLH LLPIYWMKMH VQVIFVDADQ VVRADMGDLY DMDIKGRPLA YTPFCDNNKD    1500
MDGYRFWRQG FWREHLRGRP YHISALYVVD LVKFRETAAG DNLRVFYESL SKDPNSLANL    1560
DQDLPNYAQH TVPIFSLPQE WLWCESWCGN ATKSRAKTID LCNNPMTKEP KLQGARRIVS    1620
EWTDLDFEAR KFTAKILGDE LENPDPLPSP SSSSPETSSN DQSSDDLESK AEL*          1680
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd04194GT8_A4GalT_like7.0e-913331581259+
cd00505Glyco_transf_89.0e-5013331612289+
pfam06427UDP-g_GGTase2.0e-8010021207212+
cd06432GT8_HUGT1_C_like4.0e-16813331612280+
Gene Ontology
GO TermDescription
GO:0003980UDP-glucose:glycoprotein glucosyltransferase activity
GO:0006486protein glycosylation
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAG51883.101167311674AC016162_4 putative UDP-glucose:glycoprotein glucosyltransferase; 101200-91134 [Arabidopsis thaliana]
DDBJBAD28382.10311667351626putative UDP-glucose:glycoprotein glucosyltransferase [Oryza sativa Japonica Group]
RefSeqNP_177278.301167311613EBS1 (EMS-mutagenized bri1 suppressor 1); UDP-glucose:glycoprotein glucosyltransferase/ transferase, transferring glycosyl groups / transferase, transferring hexosyl groups [Arabidopsis thaliana]
RefSeqXP_002268972.101167311611PREDICTED: similar to EBS1 (EMS-MUTAGENIZED BRI1 SUPPRESSOR 1); UDP-glucose:glycoprotein glucosyltransferase/ transferase, transferring glycosyl groups / transferase, transferring hexosyl groups [Vitis vinifera]
RefSeqXP_002529534.101156211499UDP-glucose glycoprotein:glucosyltransferase, putative [Ricinus communis]
Transmembrane Domains
StartEnd
729
Signal Peptide
Cleavage Site
28
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO415354576107316360
HO797114360127916380
DR944618308132816350
GO883503347129216380
HO41535415392410740.000000000000002