y PlantCAZyme

CAZyme Information

Basic Information
SpeciesOryza sativa
Cazyme IDLOC_Os04g39814.3
FamilyGH1
Protein PropertiesLength: 286 Molecular Weight: 32980.7 Isoelectric Point: 9.9143
ChromosomeChromosome/Scaffold: 4 Start: 23715443 End: 23721731
Descriptionbeta glucosidase 13
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1322810
  ISALQKGKIGIIVNSQWYVPFSPSKTNKDAARRVLDFVLGWLMDPLIRGDYPLNMRELVGNRLPKFTKEQSEMVKGAFDFIGLNYYSSSYAENVLPSYGL
  KNSYNTDFHARITGSRNGTLIGPQAASSWLHIYPQGLRELLLYIKENYGNPTIFITENGVDEVNNKTMPLKEALNDNTRIEYYHKHLLALRNAMRDGANV
  KGYFAWSLLDNFEWADGYTLRFGLNFVDYDDGMKRHPKNSAHWFKKFLRE
Full Sequence
Protein Sequence     Length: 286     Download
MQRWRFRKGA LHCMPSPTTC PRRNCSVVQR EISALQKGKI GIIVNSQWYV PFSPSKTNKD    60
AARRVLDFVL GWLMDPLIRG DYPLNMRELV GNRLPKFTKE QSEMVKGAFD FIGLNYYSSS    120
YAENVLPSYG LKNSYNTDFH ARITGSRNGT LIGPQAASSW LHIYPQGLRE LLLYIKENYG    180
NPTIFITENG VDEVNNKTMP LKEALNDNTR IEYYHKHLLA LRNAMRDGAN VKGYFAWSLL    240
DNFEWADGYT LRFGLNFVDY DDGMKRHPKN SAHWFKKFLR EMKQG*                   300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02849PLN028496.0e-5435280251+
PLN02998PLN029987.0e-5650280235+
COG2723BglB5.0e-5836277249+
TIGR03356BGL7.0e-6238275244+
pfam00232Glyco_hydro_13.0e-7836280251+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005488binding
GO:0005975carbohydrate metabolic process
GO:0008152metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAH66807.1027285256514OSIGBa0135C13.2 [Oryza sativa (indica cultivar-group)]
EMBLCAH66810.1023281275533OSIGBa0135C13.5 [Oryza sativa (indica cultivar-group)]
GenBankEAY94510.10322851254hypothetical protein OsI_16283 [Oryza sativa Indica Group]
GenBankEAZ31068.10322851254hypothetical protein OsJ_15164 [Oryza sativa Japonica Group]
GenBankEEC77464.1023281275533hypothetical protein OsI_16285 [Oryza sativa Indica Group]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ptq_B027279251503A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
PDB3ptq_A027279251503A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
PDB3ptm_B027279251503A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
PDB3ptm_A027279251503A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
PDB3ptk_B027279251503A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
Metabolic Pathways
Pathway NameReactionECProtein Name
coumarin biosynthesis (via 2-coumarate)RXN-8036EC-3.2.1.21β-glucosidase
linamarin degradationRXN-5341EC-3.2.1.21β-glucosidase
linustatin bioactivationRXN-13602EC-3.2.1.21β-glucosidase
linustatin bioactivationRXN-5341EC-3.2.1.21β-glucosidase
lotaustralin degradationRXN-9674EC-3.2.1.21β-glucosidase
neolinustatin bioactivationRXN-13603EC-3.2.1.21β-glucosidase
neolinustatin bioactivationRXN-9674EC-3.2.1.21β-glucosidase
taxiphyllin bioactivationRXN-13600EC-3.2.1.21β-glucosidase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CA763998225552790
HS370273180312100
CB647183217652810
FG9558371691182860
FL878741209732810
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_346_00002.1
Eucalyptus grandisEucgr.K00923.1
Fragaria vescamrna26801.1-v1.0-hybrid
Glycine maxGlyma11g13766.2Glyma08g15960.5Glyma08g15993.1Glyma08g15960.4Glyma08g15950.2
Gossypium raimondiiGorai.008G271500.8.159.363Gorai.008G271500.8.159.363
Linum usitatissimumLus10011828.473.717Lus10000225Lus10011828.473.717
Malus domesticaMDP0000285510MDP0000295323MDP0000187265
Medicago truncatulaMedtr4g015460.2
Mimulus guttatusmgv1a025884mmgv1a014264m
Panicum virgatumPavirv00040514mPavirv00034317mPavirv00068709m
Phaseolus vulgarisPhvul.011G055700.2
Picea abiesMA_173229g0010
Populus trichocarpaPotri.T019200.1.296.514Potri.T177800.2Potri.T019200.1.296.514Potri.T177800.1Potri.T177800.3
Prunus persicappa026358mppa015721m
Vitis viniferaGSVIVT01032017001GSVIVT01032006001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny