| Basic Information | |
|---|---|
| Species | Linum usitatissimum |
| Cazyme ID | Lus10000034 |
| Family | CE8 |
| Protein Properties | Length: 123 Molecular Weight: 14263.4 Isoelectric Point: 9.882 |
| Chromosome | Chromosome/Scaffold: 8223057 Start: 7 End: 375 |
| Description | Plant invertase/pectin methylesterase inhibitor superfamily |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| CE8 | 6 | 91 | 1.1e-29 |
| KEFKSYLGRPWKNFSRTIIMETFIDDLIDPEGWLPWMGTIGTKTCWYGEFGNYGPGADQSKRVTWQGIKKITPQHAVDFTPQRFIR | |||
| Full Sequence |
|---|
| Protein Sequence Length: 123 Download |
| MKADRKEFKS YLGRPWKNFS RTIIMETFID DLIDPEGWLP WMGTIGTKTC WYGEFGNYGP 60 GADQSKRVTW QGIKKITPQH AVDFTPQRFI RSDPWVKPTG IPYISYMVKP SKSRRVDTEL 120 IE* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02713 | PLN02713 | 8.0e-36 | 9 | 105 | 97 | + Probable pectinesterase/pectinesterase inhibitor | ||
| PLN02301 | PLN02301 | 1.0e-36 | 8 | 103 | 97 | + pectinesterase/pectinesterase inhibitor | ||
| PLN02217 | PLN02217 | 9.0e-37 | 3 | 104 | 102 | + probable pectinesterase/pectinesterase inhibitor | ||
| PLN02990 | PLN02990 | 2.0e-42 | 9 | 105 | 97 | + Probable pectinesterase/pectinesterase inhibitor | ||
| pfam01095 | Pectinesterase | 1.0e-46 | 2 | 93 | 93 | + Pectinesterase. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0005618 | cell wall |
| GO:0030599 | pectinesterase activity |
| GO:0042545 | cell wall modification |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CBI22967.1 | 2e-39 | 5 | 108 | 440 | 543 | unnamed protein product [Vitis vinifera] |
| EMBL | CBI39537.1 | 1e-39 | 5 | 105 | 472 | 572 | unnamed protein product [Vitis vinifera] |
| RefSeq | XP_002318979.1 | 0 | 4 | 109 | 471 | 576 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002330222.1 | 5.60519e-45 | 4 | 109 | 472 | 577 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002512459.1 | 0 | 5 | 110 | 477 | 582 | Pectinesterase precursor, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1xg2_A | 7e-29 | 6 | 104 | 213 | 312 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
| PDB | 1gq8_A | 1e-26 | 5 | 103 | 216 | 315 | A Chain A, Pectin Methylesterase From Carrot |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| JG074702 | 123 | 1 | 123 | 0 |
| JG075935 | 123 | 1 | 123 | 0 |
| JG075420 | 123 | 1 | 123 | 0 |
| JG078140 | 123 | 1 | 123 | 0 |
| JG076287 | 123 | 1 | 123 | 0 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Malus domestica | MDP0000304455.441.523 | MDP0000304455.441.523 | |||
| Sequence Alignments |
|---|
 |
| Phylogeny |
|---|
 |