y PlantCAZyme

CAZyme Information

Basic Information
SpeciesLinum usitatissimum
Cazyme IDLus10042382
FamilyAA7
Protein PropertiesLength: 279 Molecular Weight: 30949.6 Isoelectric Point: 9.603
ChromosomeChromosome/Scaffold: 123 Start: 1927159 End: 1928841
DescriptionFAD-binding Berberine family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA71382521.80067e-42
  FPAGACPTIGVGGHLDGGGYGILVRKHGMATDNVIDDYLVDARGRVLEREAMGEDVFWAIRGGGASSFGIVISWKVKLARVPPKLTFFTVNKMLEEEGAV
  KLVDKWQRFCTRRTR
Full Sequence
Protein Sequence     Length: 279     Download
MKEMRVFLAS LALMIIISIS PSTSSIQVGD NFMDCISNNG SSSSSGWVYD PESPHFSSIL    60
DSKIQNKRYL TSTSKPNLIL TPSHHCQIQA AILCAKQQSL HIRVRSGCHD YKGLSYLTRG    120
QKPYIMIDLV NLNAVHWFPA GACPTIGVGG HLDGGGYGIL VRKHGMATDN VIDDYLVDAR    180
GRVLEREAMG EDVFWAIRGG GASSFGIVIS WKVKLARVPP KLTFFTVNKM LEEEGAVKLV    240
DKWQRFCTRR TRGFLRQDSN SWGLKQASRH CLWDRLTS*                           300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam01565FAD_binding_41.0e-776185141+
Gene Ontology
GO TermDescription
GO:0008762UDP-N-acetylmuramate dehydrogenase activity
GO:0016491oxidoreductase activity
GO:0050660flavin adenine dinucleotide binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN81654.1082496279hypothetical protein [Vitis vinifera]
RefSeqXP_002268361.1082496279PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002299035.1072438275predicted protein [Populus trichocarpa]
RefSeqXP_002330565.103024728277predicted protein [Populus trichocarpa]
RefSeqXP_002330615.102224425276predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4dns_B0202441252A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens
PDB4dns_A0202441252A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens
PDB3vte_A0302555261A Chain A, Crystal Structure Of Tetrahydrocannabinolic Acid Synthase From Cannabis Sativa
PDB3tsj_B04824424250A Chain A, Crystal Structure Of Tetrahydrocannabinolic Acid Synthase From Cannabis Sativa
PDB3tsj_A04824424250A Chain A, Crystal Structure Of Tetrahydrocannabinolic Acid Synthase From Cannabis Sativa
Transmembrane Domains
StartEnd
729
Signal Peptide
Cleavage Site
25
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
JG213766222562470
JG609781236272310
CB675385245302440
JG645872233482490
CF920811229492470