Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_149082g0010 |
Family | GH104 |
Protein Properties | Length: 145 Molecular Weight: 16265.4 Isoelectric Point: 9.6733 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH104 | 1 | 136 | 0 |
MLAWSEGTDNGRQKTRNHGYDVIVGGELFTDYSDHPRKLVTLNPKLKSTGAGRYQLLSRWWDAYRKQLGLKDFSPKSQDAVALQQIKERGALPMIDRGDI RQAIDRCSNIWASLPGAGYGQFEHKADSLIAKFKEA |
Full Sequence |
---|
Protein Sequence Length: 145 Download |
MLAWSEGTDN GRQKTRNHGY DVIVGGELFT DYSDHPRKLV TLNPKLKSTG AGRYQLLSRW 60 WDAYRKQLGL KDFSPKSQDA VALQQIKERG ALPMIDRGDI RQAIDRCSNI WASLPGAGYG 120 QFEHKADSLI AKFKEAGGTV REIDV |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd00442 | lysozyme_like | 5.0e-18 | 1 | 110 | 122 | + lysozyme_like domain. This contains several members including Soluble Lytic Transglycosylases (SLT), Goose Egg-White Lysozymes (GEWL), Hen Egg-White Lysozymes (HEWL), chitinases, bacteriophage lambda lysozymes, endolysins, autolysins, and chitosanases. All the members are involved in the hydrolysis of beta-1,4- linked polysaccharides. | ||
pfam00959 | Phage_lysozyme | 5.0e-23 | 20 | 127 | 116 | + Phage lysozyme. This family includes lambda phage lysozyme and E. coli endolysin. | ||
cd00736 | bacteriophage_lambda_lysozyme | 4.0e-73 | 1 | 138 | 141 | + The lysozyme from bacteriophage lambda hydrolyses the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc), as do other lysozymes. But unlike other lysozymes, bacteriophage lambda does not produce a reducing end upon cleavage of the peptidoglycan but rather uses the 6-OH of the same MurNAc residue to produce a 1,6-anhydromuramic acid terminal residue and is therefore a lytic transglycosylase. An identical 1,6-anhydro bond is formed in bacterial peptidoglycans by the action of the lytic transglycosylases of E. coli. However, they differ structurally. | ||
COG4678 | COG4678 | 2.0e-74 | 1 | 142 | 145 | + Muramidase (phage lambda lysozyme) [Carbohydrate transport and metabolism] |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
EMBL | CBG33651.1 | 0 | 1 | 145 | 14 | 158 | phage endolysin [Escherichia coli 042] |
RefSeq | NP_037753.1 | 0 | 1 | 145 | 14 | 158 | lysin [Enterobacteria phage HK97] |
RefSeq | NP_040645.1 | 0 | 1 | 145 | 14 | 158 | endolysin [Enterobacteria phage lambda] |
RefSeq | YP_002533525.1 | 0 | 1 | 145 | 14 | 158 | Endolysin [Salmonella phage epsilon34] |
RefSeq | YP_541657.1 | 0 | 1 | 145 | 14 | 158 | lysin [Escherichia coli UTI89] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1am7_C | 0 | 1 | 145 | 14 | 158 | A Chain A, Lysozyme From Bacteriophage Lambda |
PDB | 1am7_B | 0 | 1 | 145 | 14 | 158 | A Chain A, Lysozyme From Bacteriophage Lambda |
PDB | 1am7_A | 0 | 1 | 145 | 14 | 158 | A Chain A, Lysozyme From Bacteriophage Lambda |
PDB | 3d3d_B | 0 | 1 | 141 | 14 | 154 | A Chain A, Lysozyme From Bacteriophage Lambda |
PDB | 3d3d_A | 0 | 1 | 141 | 14 | 154 | A Chain A, Lysozyme From Bacteriophage Lambda |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
AM831993 | 145 | 1 | 145 | 0 |
BQ153489 | 140 | 5 | 144 | 0 |
CO750141 | 135 | 11 | 145 | 0 |
CX632283 | 135 | 11 | 145 | 0 |
AM812797 | 131 | 1 | 131 | 0 |
Orthologous Group | |||||
---|---|---|---|---|---|
Species | ID | ||||
Picea abies | MA_1010840g0060 | ||||
Ricinus communis | 27588.m000054 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|