| Basic Information | |
|---|---|
| Species | Picea abies |
| Cazyme ID | MA_149082g0010 |
| Family | GH104 |
| Protein Properties | Length: 145 Molecular Weight: 16265.4 Isoelectric Point: 9.6733 |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH104 | 1 | 136 | 0 |
| MLAWSEGTDNGRQKTRNHGYDVIVGGELFTDYSDHPRKLVTLNPKLKSTGAGRYQLLSRWWDAYRKQLGLKDFSPKSQDAVALQQIKERGALPMIDRGDI RQAIDRCSNIWASLPGAGYGQFEHKADSLIAKFKEA | |||
| Full Sequence |
|---|
| Protein Sequence Length: 145 Download |
| MLAWSEGTDN GRQKTRNHGY DVIVGGELFT DYSDHPRKLV TLNPKLKSTG AGRYQLLSRW 60 WDAYRKQLGL KDFSPKSQDA VALQQIKERG ALPMIDRGDI RQAIDRCSNI WASLPGAGYG 120 QFEHKADSLI AKFKEAGGTV REIDV |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| cd00442 | lysozyme_like | 5.0e-18 | 1 | 110 | 122 | + lysozyme_like domain. This contains several members including Soluble Lytic Transglycosylases (SLT), Goose Egg-White Lysozymes (GEWL), Hen Egg-White Lysozymes (HEWL), chitinases, bacteriophage lambda lysozymes, endolysins, autolysins, and chitosanases. All the members are involved in the hydrolysis of beta-1,4- linked polysaccharides. | ||
| pfam00959 | Phage_lysozyme | 5.0e-23 | 20 | 127 | 116 | + Phage lysozyme. This family includes lambda phage lysozyme and E. coli endolysin. | ||
| cd00736 | bacteriophage_lambda_lysozyme | 4.0e-73 | 1 | 138 | 141 | + The lysozyme from bacteriophage lambda hydrolyses the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc), as do other lysozymes. But unlike other lysozymes, bacteriophage lambda does not produce a reducing end upon cleavage of the peptidoglycan but rather uses the 6-OH of the same MurNAc residue to produce a 1,6-anhydromuramic acid terminal residue and is therefore a lytic transglycosylase. An identical 1,6-anhydro bond is formed in bacterial peptidoglycans by the action of the lytic transglycosylases of E. coli. However, they differ structurally. | ||
| COG4678 | COG4678 | 2.0e-74 | 1 | 142 | 145 | + Muramidase (phage lambda lysozyme) [Carbohydrate transport and metabolism] | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CBG33651.1 | 0 | 1 | 145 | 14 | 158 | phage endolysin [Escherichia coli 042] |
| RefSeq | NP_037753.1 | 0 | 1 | 145 | 14 | 158 | lysin [Enterobacteria phage HK97] |
| RefSeq | NP_040645.1 | 0 | 1 | 145 | 14 | 158 | endolysin [Enterobacteria phage lambda] |
| RefSeq | YP_002533525.1 | 0 | 1 | 145 | 14 | 158 | Endolysin [Salmonella phage epsilon34] |
| RefSeq | YP_541657.1 | 0 | 1 | 145 | 14 | 158 | lysin [Escherichia coli UTI89] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1am7_C | 0 | 1 | 145 | 14 | 158 | A Chain A, Lysozyme From Bacteriophage Lambda |
| PDB | 1am7_B | 0 | 1 | 145 | 14 | 158 | A Chain A, Lysozyme From Bacteriophage Lambda |
| PDB | 1am7_A | 0 | 1 | 145 | 14 | 158 | A Chain A, Lysozyme From Bacteriophage Lambda |
| PDB | 3d3d_B | 0 | 1 | 141 | 14 | 154 | A Chain A, Lysozyme From Bacteriophage Lambda |
| PDB | 3d3d_A | 0 | 1 | 141 | 14 | 154 | A Chain A, Lysozyme From Bacteriophage Lambda |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| AM831993 | 145 | 1 | 145 | 0 |
| BQ153489 | 140 | 5 | 144 | 0 |
| CO750141 | 135 | 11 | 145 | 0 |
| CX632283 | 135 | 11 | 145 | 0 |
| AM812797 | 131 | 1 | 131 | 0 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Picea abies | MA_1010840g0060 | ||||
| Ricinus communis | 27588.m000054 | ||||
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |