y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPicea abies
Cazyme IDMA_7238242g0010
FamilyCE13
Protein PropertiesLength: 89 Molecular Weight: 10277.9 Isoelectric Point: 8.4975
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE131888.7e-26
  DQFSDLLPNRAKVKCMPDASFFLDSENVVGSKQFRFFYNHIVTFHGSLKHSPDACTLKMHLASLCFFPQYLLQLIKTRIFLVNSAYDT
Full Sequence
Protein Sequence     Length: 89     Download
DQFSDLLPNR AKVKCMPDAS FFLDSENVVG SKQFRFFYNH IVTFHGSLKH SPDACTLKMH    60
LASLCFFPQY LLQLIKTRIF LVNSAYDTL                                      120
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03283PAE3.0e-2618787+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABR16604.12e-22188226312unknown [Picea sitchensis]
GenBankEEC77932.11e-21187322407hypothetical protein OsI_17271 [Oryza sativa Indica Group]
GenBankEEE61621.12e-21187462547hypothetical protein OsJ_16047 [Oryza sativa Japonica Group]
RefSeqXP_002303225.14e-21188185271predicted protein [Populus trichocarpa]
RefSeqXP_002519912.14e-22188243329pectin acetylesterase, putative [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO159435891891e-36
CO159354891891e-36
CF667158881889e-33
CO476800891892e-31
GT236321891892e-31