y
Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_857692g0010 |
Family | AA2 |
Protein Properties | Length: 79 Molecular Weight: 8029.14 Isoelectric Point: 4.7747 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA2 | 3 | 77 | 2.1e-24 |
KNSVRGFEVIDAIKTQVEAACPGVVSCADIVAIAARDAVVQLGGPTWLVLLGRRDSTTASLSAANTDIPPPASNL |
Full Sequence |
---|
Protein Sequence Length: 79 Download |
PNKNSVRGFE VIDAIKTQVE AACPGVVSCA DIVAIAARDA VVQLGGPTWL VLLGRRDSTT 60 ASLSAANTDI PPPASNLSA 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN03030 | PLN03030 | 1.0e-11 | 6 | 79 | 74 | + cationic peroxidase; Provisional | ||
pfam00141 | peroxidase | 9.0e-19 | 1 | 79 | 79 | + Peroxidase. | ||
cd00693 | secretory_peroxidase | 2.0e-26 | 1 | 79 | 79 | + Horseradish peroxidase and related secretory plant peroxidases. Secretory peroxidases belong to class III of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class III peroxidases are found in the extracellular space or in the vacuole in plants where they have been implicated in hydrogen peroxide detoxification, auxin catabolism and lignin biosynthesis, and stress response. Class III peroxidases contain four conserved disulphide bridges and two conserved calcium binding sites. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABK21858.1 | 4.2039e-45 | 1 | 79 | 101 | 179 | unknown [Picea sitchensis] |
GenBank | ABK23423.1 | 1e-36 | 1 | 78 | 93 | 170 | unknown [Picea sitchensis] |
GenBank | ABR18139.1 | 5e-38 | 1 | 79 | 102 | 180 | unknown [Picea sitchensis] |
GenBank | ACJ11762.1 | 3e-36 | 1 | 79 | 98 | 176 | class III peroxidase [Gossypium hirsutum] |
EMBL | CAH10839.1 | 4e-39 | 1 | 79 | 92 | 170 | peroxidase [Picea abies] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1sch_B | 5e-36 | 1 | 79 | 69 | 147 | A Chain A, Peanut Peroxidase |
PDB | 1sch_A | 5e-36 | 1 | 79 | 69 | 147 | A Chain A, Peanut Peroxidase |
PDB | 1qo4_A | 3e-26 | 1 | 78 | 70 | 147 | A Chain A, Peanut Peroxidase |
PDB | 1pa2_A | 3e-26 | 1 | 78 | 70 | 147 | A Chain A, Arabidopsis Thaliana Peroxidase A2 |
PDB | 4a5g_B | 4e-24 | 1 | 78 | 71 | 148 | A Chain A, Raphanus Sativus Anionic Peroxidase. |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DR576329 | 79 | 1 | 79 | 2e-35 |
DR528105 | 79 | 1 | 79 | 3e-35 |
DR058888 | 79 | 1 | 79 | 1e-30 |
CF387396 | 79 | 1 | 79 | 1e-30 |
CF402030 | 79 | 1 | 79 | 1e-30 |
Orthologous Group | |||||
---|---|---|---|---|---|
Species | ID | ||||
Picea abies | MA_10431552g0010 | MA_8146226g0010 | MA_996954g0010 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|