y PlantCAZyme

CAZyme Information

Basic Information
SpeciesMalus domestica
Cazyme IDMDP0000127542
FamilyGH35
Protein PropertiesLength: 811 Molecular Weight: 90482.8 Isoelectric Point: 8.8105
ChromosomeChromosome/Scaffold: 01314884 Start: 9743 End: 14600
Descriptionbeta-galactosidase 12
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH353434226.3e-31
  YTEFGGAIPTRPVEDLAFSVARFIQSGGSFFNYYMYHGGTNFGRTAGGPFMATSYDYDAPLDEYGLLQQPKWGHLKDLHK
GH35342250
  IINGQRRILISGSIHYPRSTPEMWPDLIQKAKAGGLDVIQTYVFWNGHEPSPGKYYFEDRYDLVKFIKLVQQAGLFVNLRIGPYVCAEWNFGGFPIWLKY
  VPGIAFRTDNEPFKAAMQKFTEKIVNMMKAEKLFQTEGGPIILSQIENEYGPVEWEIGAPGKAYTKWAAQMAVGLNTGVPWIMCKQEDAPDP
Full Sequence
Protein Sequence     Length: 811     Download
MGVGIQTMWS ILLLLSCIFS AASASVGYDH KAIIINGQRR ILISGSIHYP RSTPEMWPDL    60
IQKAKAGGLD VIQTYVFWNG HEPSPGKYYF EDRYDLVKFI KLVQQAGLFV NLRIGPYVCA    120
EWNFGGFPIW LKYVPGIAFR TDNEPFKAAM QKFTEKIVNM MKAEKLFQTE GGPIILSQIE    180
NEYGPVEWEI GAPGKAYTKW AAQMAVGLNT GVPWIMCKQE DAPDPVLFNY KSNIIVLPRS    240
SGPLSFGIEG GCLRPVTLTE ELISPYLLCD RLTPAMVTTV RISSQTRSTS QKCGQKSGLV    300
GKSHKLPVQL KSSFPWLRHI GFFLYCCSIP LTRLPLLYVF YRYTEFGGAI PTRPVEDLAF    360
SVARFIQSGG SFFNYYMYHG GTNFGRTAGG PFMATSYDYD APLDEYGLLQ QPKWGHLKDL    420
HKAIKSCEYA LVAVDPSVTK LGNNQEAHVF NTKSGCAAFL ANYDTKYPVR VSFGQGQYDL    480
PPWSISILPD CKTAVFNTAK VTWKTSQVQM KPVYXRLPWQ SFIEETTTSD ESGTTTLDGL    540
YEQIYMTRDA TDYLWYMTDI TIGSDEAFLN NGKFPLLTIF SAGHALHVFI NGQLSGTVYG    600
SLENPKLTFS QNVKLRPGIN KLALLSISVG LPNVGTHFET WNAGVLGPIS LKGLNTGTWD    660
MSRWKWTYKI GMKGEALGLH TVTGSSSVDW AEGPSMAKKQ PLTWYKATFN APPGHAPLAL    720
DMGSMGKGQI WINGQSVGRH WPGYIAQGSC GTCNYAGTFY DKKCRTYCGK PSQRWYHIPR    780
SWLTPTGNLL VVFEEWGGDP QWMSLVERVR V                                   840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG1874LacA1.0e-2026187172+
pfam01301Glyco_hydro_351.0e-3134342485+
pfam01301Glyco_hydro_351.0e-10032228201+
PLN03059PLN030593.0e-1358227220+
PLN03059PLN030590343808466+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004565beta-galactosidase activity
GO:0005975carbohydrate metabolic process
GO:0009341beta-galactosidase complex
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAD91081.1012391247beta-D-galactosidase [Pyrus pyrifolia]
DDBJBAD91081.10343811257725beta-D-galactosidase [Pyrus pyrifolia]
DDBJBAE72074.1012391247pear beta-galactosidase2 [Pyrus communis]
DDBJBAE72074.10343811257725pear beta-galactosidase2 [Pyrus communis]
EMBLCAN78072.102480927728hypothetical protein [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3thd_D2e-322518410167A Chain A, Recombinant Horseradish Peroxidase C1a Ala140gly
PDB3thd_D0.005352411260322A Chain A, Recombinant Horseradish Peroxidase C1a Ala140gly
PDB3thd_C2e-322518410167A Chain A, Recombinant Horseradish Peroxidase C1a Ala140gly
PDB3thd_C0.005352411260322A Chain A, Recombinant Horseradish Peroxidase C1a Ala140gly
Signal Peptide
Cleavage Site
24
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7806024673438090
HO780602152762270
HO7781604703438090
HO778160221112270
HO7955523823437240
Orthologous Group
SpeciesID
Citrus sinensisorange1.1g007110m
Cucumis sativusCucsa.229010.4Cucsa.063990.1
Malus domesticaMDP0000127542.343.422MDP0000127542.343.422
Panicum virgatumPavirv00045198mPavirv00064168m
Populus trichocarpaPotri.001G200400.6
Setaria italicaSi006287mSi006174m.279.374Si006174m.279.374Si005914m.279.374Si005914m.279.374
Si006347m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny