| Basic Information | |
|---|---|
| Species | Malus domestica |
| Cazyme ID | MDP0000233619 |
| Family | GH17 |
| Protein Properties | Length: 117 Molecular Weight: 12921 Isoelectric Point: 10.4718 |
| Chromosome | Chromosome/Scaffold: 000706499 Start: 18050 End: 18403 |
| Description | O-Glycosyl hydrolases family 17 protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH17 | 29 | 116 | 3.5e-29 |
| IGVNWGSVSFHRLKPSAVVDLMKDNKISKVKLFDADPDSLRALMGSGIQVMVGIPNEMLAALSSSTDASDLWVRQNVSRYMVKNGADI | |||
| Full Sequence |
|---|
| Protein Sequence Length: 117 Download |
| MLEARRKWSW AFAAALLSLV VVWRAESAIG VNWGSVSFHR LKPSAVVDLM KDNKISKVKL 60 FDADPDSLRA LMGSGIQVMV GIPNEMLAAL SSSTDASDLW VRQNVSRYMV KNGADIR 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam00332 | Glyco_hydro_17 | 3.0e-11 | 29 | 108 | 80 | + Glycosyl hydrolases family 17. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CAN82722.1 | 9.99995e-41 | 25 | 117 | 2 | 94 | hypothetical protein [Vitis vinifera] |
| RefSeq | NP_193451.2 | 4e-39 | 15 | 117 | 11 | 108 | glycosyl hydrolase family 17 protein [Arabidopsis thaliana] |
| RefSeq | XP_002271875.1 | 1e-39 | 26 | 117 | 36 | 127 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002329964.1 | 0 | 25 | 117 | 25 | 117 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002525026.1 | 1.99965e-42 | 11 | 117 | 3 | 114 | Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2cyg_A | 0.00000000007 | 29 | 108 | 1 | 80 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 1ghr_A | 0.000000007 | 29 | 108 | 1 | 80 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 1aq0_B | 0.000000007 | 29 | 108 | 1 | 80 | A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group |
| PDB | 1aq0_A | 0.000000007 | 29 | 108 | 1 | 80 | A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group |
| PDB | 3f55_D | 0.0000002 | 29 | 105 | 2 | 77 | A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group |
| Signal Peptide | ||||
|---|---|---|---|---|
 | ||||
| Cleavage Site | ||||
| 25 | ||||
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| GO523212 | 117 | 1 | 117 | 0 |
| EB148042 | 117 | 1 | 117 | 0 |
| CN916781 | 117 | 1 | 117 | 0 |
| CN939747 | 117 | 1 | 117 | 0 |
| DB878128 | 93 | 25 | 117 | 5.99994e-41 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |