| Basic Information | |
|---|---|
| Species | Malus domestica |
| Cazyme ID | MDP0000926809 |
| Family | GH1 |
| Protein Properties | Length: 118 Molecular Weight: 13092.8 Isoelectric Point: 9.1506 |
| Chromosome | Chromosome/Scaffold: 002826264 Start: 73 End: 598 |
| Description | thioglucoside glucohydrolase 1 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH1 | 2 | 112 | 5.9e-29 |
| HFGDRAKRWLTLNEPFTVNNHGYAIGTHAPGRCSAWQKLNCIGGNSAVEPYLVTHHQLLSHAAAVKLYKTKYQEYQNGAIGLAVVTHWFEPASKAKKDID AANRALDFMFG | |||
| Full Sequence |
|---|
| Protein Sequence Length: 118 Download |
| MHFGDRAKRW LTLNEPFTVN NHGYAIGTHA PGRCSAWQKL NCIGGNSAVE PYLVTHHQLL 60 SHAAAVKLYK TKYQEYQNGA IGLAVVTHWF EPASKAKKDI DAANRALDFM FGCNNNY* 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02998 | PLN02998 | 1.0e-19 | 3 | 112 | 110 | + beta-glucosidase | ||
| TIGR03356 | BGL | 8.0e-20 | 2 | 110 | 109 | + beta-galactosidase. | ||
| PLN02814 | PLN02814 | 6.0e-24 | 3 | 112 | 112 | + beta-glucosidase | ||
| PLN02849 | PLN02849 | 2.0e-26 | 3 | 112 | 110 | + beta-glucosidase | ||
| pfam00232 | Glyco_hydro_1 | 6.0e-28 | 3 | 112 | 111 | + Glycosyl hydrolase family 1. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAA91166.1 | 0 | 2 | 112 | 184 | 294 | beta-glucosidase [Prunus avium] |
| GenBank | AAA93234.2 | 0 | 3 | 112 | 197 | 306 | amygdalin hydrolase isoform AH I precursor [Prunus serotina] |
| GenBank | AAF34650.1 | 0 | 3 | 112 | 195 | 302 | AF221526_1 prunasin hydrolase isoform PHA precursor [Prunus serotina] |
| GenBank | AAL07435.1 | 0 | 3 | 112 | 169 | 276 | AF413214_1 prunasin hydrolase isoform PH A precursor [Prunus serotina] |
| GenBank | AAL07489.1 | 0 | 3 | 112 | 172 | 281 | AF414606_1 amygdalin hydrolase isoform AH I precursor [Prunus serotina] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1cbg_A | 4.99983e-42 | 2 | 112 | 170 | 280 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
| PDB | 3ptq_B | 1.99993e-41 | 2 | 112 | 185 | 295 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
| PDB | 3ptq_A | 1.99993e-41 | 2 | 112 | 185 | 295 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
| PDB | 3ptm_B | 1.99993e-41 | 2 | 112 | 185 | 295 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
| PDB | 3ptm_A | 1.99993e-41 | 2 | 112 | 185 | 295 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| BI311485 | 111 | 2 | 112 | 0 |
| CB893273 | 111 | 2 | 112 | 0 |
| CB893105 | 113 | 2 | 114 | 0 |
| JK617476 | 111 | 2 | 112 | 0 |
| BU572569 | 100 | 13 | 112 | 0 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |