| Basic Information | |
|---|---|
| Species | Panicum virgatum |
| Cazyme ID | Pavirv00051180m |
| Family | GH1 |
| Protein Properties | Length: 154 Molecular Weight: 17560.8 Isoelectric Point: 5.2754 |
| Chromosome | Chromosome/Scaffold: 023219 Start: 68 End: 1993 |
| Description | beta glucosidase 42 |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH1 | 16 | 142 | 0 |
| ERAASEWLFIVPWGLHKLLNYIAKKYDNPAIYITENGMDEEDDQSATLEQVLNDTTRVGYFKGYLASVAQAIKDGVDVRGYFAWSFLDNFEWAMGYTKRF GIVYVDYKNGLSRHPKASAMWFSRFLK | |||
| Full Sequence |
|---|
| Protein Sequence Length: 154 Download |
| MYLLAEKWNS GEKIGERAAS EWLFIVPWGL HKLLNYIAKK YDNPAIYITE NGMDEEDDQS 60 ATLEQVLNDT TRVGYFKGYL ASVAQAIKDG VDVRGYFAWS FLDNFEWAMG YTKRFGIVYV 120 DYKNGLSRHP KASAMWFSRF LKGEAAENKA DTN* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02814 | PLN02814 | 9.0e-31 | 26 | 143 | 119 | + beta-glucosidase | ||
| COG2723 | BglB | 8.0e-31 | 17 | 137 | 122 | + Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] | ||
| PRK13511 | PRK13511 | 5.0e-31 | 14 | 137 | 136 | + 6-phospho-beta-galactosidase; Provisional | ||
| TIGR03356 | BGL | 2.0e-45 | 15 | 137 | 123 | + beta-galactosidase. | ||
| pfam00232 | Glyco_hydro_1 | 2.0e-47 | 15 | 143 | 129 | + Glycosyl hydrolase family 1. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ACN27151.1 | 0 | 5 | 148 | 4 | 147 | unknown [Zea mays] |
| GenBank | EEC71957.1 | 0 | 6 | 153 | 336 | 472 | hypothetical protein OsI_04787 [Oryza sativa Indica Group] |
| RefSeq | NP_001045089.1 | 0 | 6 | 153 | 336 | 483 | Os01g0897600 [Oryza sativa (japonica cultivar-group)] |
| RefSeq | NP_001146483.1 | 0 | 6 | 146 | 336 | 476 | hypothetical protein LOC100280071 [Zea mays] |
| RefSeq | XP_002456785.1 | 0 | 6 | 153 | 461 | 608 | hypothetical protein SORBIDRAFT_03g042690 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3f5l_B | 1.4013e-45 | 10 | 142 | 351 | 480 | A Chain A, Crystal Structure Of Uncharacterized Conserved Protein From Thermus Thermophilus Hb8 |
| PDB | 3f5l_A | 1.4013e-45 | 10 | 142 | 351 | 480 | A Chain A, Crystal Structure Of Uncharacterized Conserved Protein From Thermus Thermophilus Hb8 |
| PDB | 3f5k_B | 1.4013e-45 | 10 | 142 | 351 | 480 | A Chain A, Crystal Structure Of Uncharacterized Conserved Protein From Thermus Thermophilus Hb8 |
| PDB | 3f5k_A | 1.4013e-45 | 10 | 142 | 351 | 480 | A Chain A, Crystal Structure Of Uncharacterized Conserved Protein From Thermus Thermophilus Hb8 |
| PDB | 3f5j_B | 1.4013e-45 | 10 | 142 | 351 | 480 | A Chain A, Crystal Structure Of Uncharacterized Conserved Protein From Thermus Thermophilus Hb8 |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| coumarin biosynthesis (via 2-coumarate) | RXN-8036 | EC-3.2.1.21 | β-glucosidase |
| linamarin degradation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
| linustatin bioactivation | RXN-13602 | EC-3.2.1.21 | β-glucosidase |
| linustatin bioactivation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
| lotaustralin degradation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
| neolinustatin bioactivation | RXN-13603 | EC-3.2.1.21 | β-glucosidase |
| neolinustatin bioactivation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
| taxiphyllin bioactivation | RXN-13600 | EC-3.2.1.21 | β-glucosidase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| JG832091 | 149 | 6 | 154 | 0 |
| JG871611 | 149 | 6 | 154 | 0 |
| JG874459 | 149 | 6 | 154 | 0 |
| FL820162 | 149 | 6 | 154 | 0 |
| JG789065 | 149 | 6 | 154 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |