y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.002G168400.1
FamilyGT35
Protein PropertiesLength: 977 Molecular Weight: 111353 Isoelectric Point: 5.2699
ChromosomeChromosome/Scaffold: 02 Start: 31098506 End: 31107502
DescriptionGlycosyl transferase, family 35
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT351695190
  ALRKLGHNLEDVANKEPDAALGNGGLGRLASCFLDSLATLNYPAWGYGLRYKYGLFKQHITRDGQVEVAENWLEMGNPWEILRNDVSYPVKFYGEVIPGP
  NGSKQWVGGENILAVAYDVPIPGYKTRTTINLRLWSTKVSQEEFDLLAFNSGDHAKAYAVLKNAEKICYVLYPGDESIEGKTLRLKQQYTLCSASLQDII
  ARFEKRSGKSVNWDTLPDKVVVQMNDTHPTLCIPELIRILMDVKGLSWEKSWNMTKRTVAYTNHTVLPEALEKWSLTLLQDLLPRHVGIIRMIDEELIHE
  IISEYGIDDLELLQERLKKMRILENIELPCSVMELLSTEETSTVDPVKEIH
GT355709710
  PKLPMMVRMANLCVAGGFSVNGVAAIHSEIVKVEVFNEFYKLWPEKFQNKTNGVTPRRWIRFCNPDLSKIITKWIGTEDWVTDLEKLAILRKFADNEDLQ
  LEWIEAKKINKIKVASFIKDKTGYVVNPSAMFDVQVKRIHEYKRQLLNIMGIVYRYKKMKEMSAEERKEIFVPRVCIFGGKAFATYVQAKRIVKFITDVG
  ATINCDPDIGDLLKVVFVPDYNVSVAEMLIPGSELSQHISTAGMEASGTSNMKFAMNGCIVIGTLDGANVEIREEVGEDNFFLFGARAEEIAGLRKERAE
  GKFVPDPRFEEVKAYVRSGVFGPYNYEELMGSLEGNEGYGRADYFLVGKDFPSYLECQEQVDKAYRDQKRWTKMSIMNTAGSYKFSSDRTIHEYARDIWR
  IE
Full Sequence
Protein Sequence     Length: 977     Download
MAALPFSTTC SHSNSPLHHN SRSSFIGFSQ RNNLWQLLVI TKSISRRAIR KLSVKNVASD    60
EKQELKDPLT KRDTFHDFVP DSSSIASSIK FHAEFTSHFS PEKFELNKAF FATAESVRDS    120
LIINWNATND YYERKNVKLA YYMSMEYLQG RALLNAIGNL QLLGPYAEAL RKLGHNLEDV    180
ANKEPDAALG NGGLGRLASC FLDSLATLNY PAWGYGLRYK YGLFKQHITR DGQVEVAENW    240
LEMGNPWEIL RNDVSYPVKF YGEVIPGPNG SKQWVGGENI LAVAYDVPIP GYKTRTTINL    300
RLWSTKVSQE EFDLLAFNSG DHAKAYAVLK NAEKICYVLY PGDESIEGKT LRLKQQYTLC    360
SASLQDIIAR FEKRSGKSVN WDTLPDKVVV QMNDTHPTLC IPELIRILMD VKGLSWEKSW    420
NMTKRTVAYT NHTVLPEALE KWSLTLLQDL LPRHVGIIRM IDEELIHEII SEYGIDDLEL    480
LQERLKKMRI LENIELPCSV MELLSTEETS TVDPVKEIHV DDNDVKATEK EEEKDDDDEV    540
GEEEQEEDSD NPSIEEDTDN KVEMRFKVDP KLPMMVRMAN LCVAGGFSVN GVAAIHSEIV    600
KVEVFNEFYK LWPEKFQNKT NGVTPRRWIR FCNPDLSKII TKWIGTEDWV TDLEKLAILR    660
KFADNEDLQL EWIEAKKINK IKVASFIKDK TGYVVNPSAM FDVQVKRIHE YKRQLLNIMG    720
IVYRYKKMKE MSAEERKEIF VPRVCIFGGK AFATYVQAKR IVKFITDVGA TINCDPDIGD    780
LLKVVFVPDY NVSVAEMLIP GSELSQHIST AGMEASGTSN MKFAMNGCIV IGTLDGANVE    840
IREEVGEDNF FLFGARAEEI AGLRKERAEG KFVPDPRFEE VKAYVRSGVF GPYNYEELMG    900
SLEGNEGYGR ADYFLVGKDF PSYLECQEQV DKAYRDQKRW TKMSIMNTAG SYKFSSDRTI    960
HEYARDIWRI EPFELA*                                                   1020
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00343Phosphorylase3.0e-131169521353+
TIGR02093P_ylase6.0e-16289521436+
cd04300GT1_Glycogen_Phosphorylase086970894+
pfam00343Phosphorylase0576972402+
TIGR02093P_ylase0575970401+
Gene Ontology
GO TermDescription
GO:0004645phosphorylase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI27267.1019731930unnamed protein product [Vitis vinifera]
Swiss-ProtP5353505897554973PHSL2_SOLTU RecName: Full=Alpha-1,4 glucan phosphorylase L-2 isozyme, chloroplastic/amyloplastic; AltName: Full=Starch phosphorylase L-2; Flags: Precursor
RefSeqXP_002274575.1019731978PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002316098.1019751952predicted protein [Populus trichocarpa]
RefSeqXP_002512108.1019751972glycogen phosphorylase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1z8d_A0576972440830A Chain A, Crystal Structure Of Human Muscle Glycogen Phosphorylase A With Amp And Glucose
PDB1z8d_A011051953460A Chain A, Crystal Structure Of Human Muscle Glycogen Phosphorylase A With Amp And Glucose
PDB2azd_B0576969404793A Chain A, Crystal Structure Of Human Muscle Glycogen Phosphorylase A With Amp And Glucose
PDB2azd_B013646257375A Chain A, Crystal Structure Of Human Muscle Glycogen Phosphorylase A With Amp And Glucose
PDB2azd_A0576969404793A Chain A, Crystal Structure Of Human Muscle Glycogen Phosphorylase A With Amp And Glucose
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7783038671099750
HO7971783995779750
HO6207674015759750
HO6139544015759750
HO77830396211110.00006
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00755.3Aquca_009_00755.2Aquca_009_00755.1Aquca_002_00786.1Aquca_002_00786.2
Arabidopsis lyrata485074323006
Arabidopsis thalianaAT3G46970.1AT3G29320.1
Brachypodium distachyonBradi2g55120.1Bradi1g08070.1.569.972Bradi1g08070.1.569.972Bradi1g08070.1.163.525Bradi1g08070.1.163.525
Brassica rapaBra018180Bra025392Bra033098
Carica papayaevm.model.supercontig_27.5evm.model.supercontig_112.64.358.739evm.model.supercontig_112.64.358.739evm.model.supercontig_14.158evm.model.supercontig_112.64.117.357
evm.model.supercontig_112.64.117.357
Capsella rubellaCarubv10019408mCarubv10016634m
Chlamydomonas reinhardtiiCre12.g552200.t1.2Cre07.g336950.t1.1
Citrus clementinaCiclev10027815mCiclev10027813mCiclev10010975m.585.995Ciclev10010975m.585.995Ciclev10010975m.176.514
Ciclev10010975m.176.514
Citrus sinensisorange1.1g004485morange1.1g003202morange1.1g003197morange1.1g003196morange1.1g003188m
orange1.1g003186morange1.1g005595morange1.1g003693morange1.1g003742morange1.1g004697m
orange1.1g004696morange1.1g007597morange1.1g003875m.374.784orange1.1g003875m.374.784orange1.1g003079m.434.844
orange1.1g003079m.434.844orange1.1g003074m.434.844orange1.1g003074m.434.844orange1.1g003072m.434.844orange1.1g003072m.434.844
orange1.1g003055m.436.846orange1.1g003055m.436.846orange1.1g001879m.585.995orange1.1g001879m.585.995orange1.1g009651m
orange1.1g002111morange1.1g012447morange1.1g005402m.400.692orange1.1g005402m.400.692orange1.1g005402m.25.349
orange1.1g005402m.25.349orange1.1g003079m.25.349orange1.1g003079m.25.349orange1.1g003074m.25.349orange1.1g003074m.25.349
orange1.1g003072m.25.349orange1.1g003072m.25.349orange1.1g001879m.176.500orange1.1g001879m.176.500orange1.1g003055m.25.351
orange1.1g003055m.25.351orange1.1g026345m
Cucumis sativusCucsa.126920.10Cucsa.126920.1Cucsa.139040.4Cucsa.139040.3Cucsa.139040.2
Cucsa.139040.1Cucsa.284600.1Cucsa.273090.1
Eucalyptus grandisEucgr.B02278.2Eucgr.B02278.1Eucgr.B03166.3Eucgr.B03166.2Eucgr.J01374.1
Eucgr.B03166.1Eucgr.B03166.5Eucgr.B03166.4
Fragaria vescamrna29749.1-v1.0-hybridmrna07968.1-v1.0-hybridmrna04322.1-v1.0-hybrid.157.481mrna04322.1-v1.0-hybrid.157.481
Glycine maxGlyma13g30920.2Glyma13g30920.3Glyma08g45210.1Glyma18g07480.1Glyma20g03250.4.554.965
Glyma20g03250.4.554.965Glyma20g03250.3.562.973Glyma20g03250.3.562.973Glyma20g03250.2.562.973Glyma20g03250.2.562.973
Glyma13g06040.1Glyma19g03490.1Glyma20g03250.4.161.485Glyma20g03250.4.161.485Glyma20g03250.3.169.493
Glyma20g03250.3.169.493Glyma20g03250.2.169.493Glyma20g03250.2.169.493
Gossypium raimondiiGorai.009G166800.1Gorai.013G260900.2Gorai.013G260900.1Gorai.013G260900.3Gorai.006G011500.7.330.728
Gorai.006G011500.7.330.728Gorai.006G011500.4.514.912Gorai.006G011500.4.514.912Gorai.006G011500.3.580.978Gorai.006G011500.3.580.978
Gorai.006G011500.2.583.981Gorai.006G011500.2.583.981Gorai.006G011500.1.583.986Gorai.006G011500.1.583.986Gorai.013G092200.1
Gorai.013G092200.2Gorai.006G011500.6.177.501Gorai.006G011500.6.177.501Gorai.006G011500.5.180.504Gorai.006G011500.5.180.504
Gorai.006G011500.4.111.435Gorai.006G011500.4.111.435Gorai.006G011500.3.177.501Gorai.006G011500.3.177.501Gorai.006G011500.2.180.504
Gorai.006G011500.2.180.504Gorai.006G011500.1.180.504Gorai.006G011500.1.180.504Gorai.006G011500.6.580.815Gorai.006G011500.6.580.815
Gorai.006G011500.5.583.818Gorai.006G011500.5.583.818
Linum usitatissimumLus10036892Lus10042688Lus10037093Lus10029643Lus10029644
Malus domesticaMDP0000288190MDP0000123354MDP0000266061MDP0000129346.602.999MDP0000129346.602.999
MDP0000145828MDP0000128518MDP0000778598MDP0000259799MDP0000129346.170.509
MDP0000129346.170.509MDP0000211642
Manihot esculentacassava4.1_001626mcassava4.1_002082mcassava4.1_024481mcassava4.1_002466mcassava4.1_002614m.310.707
cassava4.1_002614m.310.707cassava4.1_001096mcassava4.1_025456mcassava4.1_007176mcassava4.1_004717m.211.560
cassava4.1_004717m.211.560cassava4.1_002614m.25.217cassava4.1_002614m.25.217cassava4.1_004717m.25.195cassava4.1_004717m.25.195
cassava4.1_009211m
Medicago truncatulaMedtr2g014460.1Medtr6g014480.1Medtr4g082950.1.578.876Medtr4g082950.1.578.876Medtr4g082950.1.170.494
Medtr4g082950.1.170.494Medtr6g014480.2
Mimulus guttatusmgv1a000698mmgv1a001277mmgv1a000878mmgv1a002586mmgv1a002585m
Oryza sativaLOC_Os01g63270.1LOC_Os01g63270.2LOC_Os03g55090.1
Panicum virgatumPavirv00009874mPavirv00050649mPavirv00050650mPavirv00004990m.515.914Pavirv00004990m.515.914
Pavirv00034922m.529.918Pavirv00034922m.529.918Pavirv00034922m.119.465Pavirv00034922m.119.465Pavirv00004990m.97.438
Pavirv00004990m.97.438
Physcomitrella patensPp1s30_182V6.1Pp1s180_124V6.1Pp1s86_213V6.1Pp1s195_41V6.1Pp1s53_212V6.1.566.981
Pp1s53_212V6.1.566.981Pp1s53_212V6.1.179.499Pp1s53_212V6.1.179.499
Phaseolus vulgarisPhvul.006G182300.1Phvul.006G064100.1Phvul.002G168400.1.570.971Phvul.002G168400.1.570.971Phvul.004G034400.1.582.980
Phvul.004G034400.1.582.980Phvul.002G168400.1.169.519Phvul.002G168400.1.169.519Phvul.004G034400.1.180.504Phvul.004G034400.1.180.504
Picea abiesMA_10437129g0010MA_14581g0010MA_10428980g0010
Populus trichocarpaPotri.004G048600.1Potri.004G048600.2Potri.009G041800.1Potri.009G041800.3Potri.010G160200.2
Potri.009G041800.4Potri.009G041800.2.126.655Potri.009G041800.2.126.655Potri.004G123600.5Potri.010G160200.5
Potri.010G160200.1Potri.010G160200.7Potri.010G160200.4Potri.010G160200.3Potri.004G123600.4.176.534
Potri.004G123600.4.176.534Potri.004G123600.3.176.534Potri.004G123600.3.176.534Potri.004G123600.2.176.534Potri.004G123600.2.176.534
Potri.004G123600.1.176.533Potri.004G123600.1.176.533Potri.010G160200.6Potri.009G041800.2.660.825Potri.009G041800.2.660.825
Prunus persicappa000587mppa001354mppa000958mppa000827m.586.983ppa000827m.586.983
ppa000827m.171.506ppa000827m.171.506
Ricinus communis29751.m00179630190.m011310.461.94330190.m011310.461.94330174.m00913629630.m000793
30190.m011310.264.44430190.m011310.264.444
Setaria italicaSi000306mSi034019m
Selaginella moellendorffii148158164611184206
Sorghum bicolorSb03g040060.1Sb01g007560.2.550.949Sb01g007560.2.550.949Sb01g007560.1.580.979Sb01g007560.1.580.979
Sb01g007560.2.140.492Sb01g007560.2.140.492Sb01g007560.1.170.522Sb01g007560.1.170.522
Thellungiella halophilaThhalv10010122mThhalv10003599m
Vitis viniferaGSVIVT01021111001GSVIVT01024804001GSVIVT01012194001GSVIVT01011504001.577.977GSVIVT01011504001.577.977
GSVIVT01011504001.177.501GSVIVT01011504001.177.501
Volvox carteriVocar20006426mVocar20001423m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)