y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.002G297600.1
FamilyCBM49
Protein PropertiesLength: 623 Molecular Weight: 68485 Isoelectric Point: 8.5829
ChromosomeChromosome/Scaffold: 02 Start: 46063305 End: 46068164
Descriptionglycosyl hydrolase 9C2
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM495306072.8e-39
  ISIEQKVTTSWVANGKTYYRYSTVVTNKSNKSLNSLNLSISKLYGPIWGLTKSGDSYTFPSWLSSLAAGKSLEFVYIH
GH9254860
  DYGQALSKSLLFFEAQRSGYLPHNQRVTWRAHSGLQDGKASGVDLVGGYYDAGDNVKFGLPMAFTVTMMSWSIIEYGKQMAANGELGHAMEAVKWGTDYF
  IKAHPQANVLYGEVGDGNTDHYCWQRPEDMTTDRHAYKIDPSNPGSDLAGETAAAMAAASIVFRRSNPAYSHELLSHAYQLFDFADKYRGKYDSSITVAQ
  KYYRSISGYNDELLWAAAWLYQASNNQYYLDYLGRNGDSMGGTGWSMTEFGWDVKYAGVQTLVAKFLMEGKAAHHAPVFERYQQKAESFMCSCLGKGSRN
  VQKTPGGLIFRQRWNNMQFVTSASFLATVYADYLTSSRTNLRCNSGNVAPAELLSLAKSQVDYLLGNNPRATSYMVGYGNNFPQRVHHRGSSIVSIKANP
  SFVSCRGGYDTWFSSKKSDPNLLTGALVGGPDAYDDFADERDNYEQTEPATYNNAPLIGILA
Full Sequence
Protein Sequence     Length: 623     Download
MEKLICISPF LLLLLSLPFS SAGHDYGQAL SKSLLFFEAQ RSGYLPHNQR VTWRAHSGLQ    60
DGKASGVDLV GGYYDAGDNV KFGLPMAFTV TMMSWSIIEY GKQMAANGEL GHAMEAVKWG    120
TDYFIKAHPQ ANVLYGEVGD GNTDHYCWQR PEDMTTDRHA YKIDPSNPGS DLAGETAAAM    180
AAASIVFRRS NPAYSHELLS HAYQLFDFAD KYRGKYDSSI TVAQKYYRSI SGYNDELLWA    240
AAWLYQASNN QYYLDYLGRN GDSMGGTGWS MTEFGWDVKY AGVQTLVAKF LMEGKAAHHA    300
PVFERYQQKA ESFMCSCLGK GSRNVQKTPG GLIFRQRWNN MQFVTSASFL ATVYADYLTS    360
SRTNLRCNSG NVAPAELLSL AKSQVDYLLG NNPRATSYMV GYGNNFPQRV HHRGSSIVSI    420
KANPSFVSCR GGYDTWFSSK KSDPNLLTGA LVGGPDAYDD FADERDNYEQ TEPATYNNAP    480
LIGILARLSG RGGYNQLLPV VPAPKPIAVK PQPSPNTKTT PSPVSWSSPI SIEQKVTTSW    540
VANGKTYYRY STVVTNKSNK SLNSLNLSIS KLYGPIWGLT KSGDSYTFPS WLSSLAAGKS    600
LEFVYIHSTS PADVSVANYV LA*                                            660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02171PLN02171022622603+
PLN02340PLN02340022619604+
PLN02420PLN02420022488469+
PLN00119PLN00119025489465+
pfam00759Glyco_hydro_9025486464+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005576extracellular region
GO:0005975carbohydrate metabolic process
GO:0030246carbohydrate binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABC94542.10236221602endo-1,4-beta-glucanase [Glycine max]
EMBLCAI68020.102362225620endo-beta-1,4-glucanase [Prunus persica]
RefSeqXP_002270880.1036226629PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002299478.1016221622predicted protein [Populus trichocarpa]
RefSeqXP_002303645.102262124621glycosyl hydrolase family 9 [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ksd_A0244923432A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp
PDB1ksc_A0244923432A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp
PDB1ks8_A0244923432A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB2xfg_A01848818459B Chain B, Reassembly And Co-Crystallization Of A Family 9 Processive Endoglucanase From Separately Expressed Gh9 And Cbm3c Modules
PDB4tf4_B0255065458B Chain B, Reassembly And Co-Crystallization Of A Family 9 Processive Endoglucanase From Separately Expressed Gh9 And Cbm3c Modules
Signal Peptide
Cleavage Site
22
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO783495378284050
ES821522365283890
FG8295802692024700
DW0690633111384480
DY9226283061434480
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01464.1.518.596Aquca_037_00141.1.542.619Aquca_013_00114.1.534.611
Arabidopsis lyrata474038.535.614489943.534.611892975.528.605
Arabidopsis thalianaAT1G64390.1.528.605AT1G48930.1.535.614AT4G11050.1.534.611
Brachypodium distachyonBradi2g32270.1.538.616Bradi2g07150.1.534.613
Brassica rapaBra032270.517.596Bra000732.268.345Bra027699.529.606Bra018765.532.611Bra027735.528.605
Carica papayaevm.model.supercontig_183.4.367.446evm.TU.contig_27379.2.529.606
Capsella rubellaCarubv10012624m.534.613Carubv10003874m.535.612Carubv10019981m.528.605
Citrus clementinaCiclev10019301m.537.614Ciclev10033912m.569.648
Citrus sinensisorange1.1g043219m.499.578orange1.1g019436m.249.326orange1.1g017562m.277.354orange1.1g011712m.387.464orange1.1g006835m.537.614
Cucumis sativusCucsa.107370.1.527.604Cucsa.128330.1.503.582Cucsa.303850.1.533.608
Eucalyptus grandisEucgr.D01733.1.529.606Eucgr.J00862.1.484.562Eucgr.E00858.1.526.602Eucgr.D01896.1
Fragaria vescamrna32087.1-v1.0-hybrid.632.709mrna11058.1-v1.0-hybrid.533.612
Glycine maxGlyma12g03050.1.537.616Glyma05g36930.1.532.609Glyma08g02610.1.533.610Glyma11g10760.1.535.614
Gossypium raimondiiGorai.003G080800.1.533.609Gorai.008G254000.1.534.611Gorai.004G133700.1.536.613Gorai.005G210200.1.530.608
Linum usitatissimumLus10003888.529.606Lus10010201.535.613Lus10032377.534.611Lus10017402.508.586Lus10001833.527.603
Lus10033956
Malus domesticaMDP0000276676.536.613MDP0000131267.528.605MDP0000548943MDP0000722052.313.390MDP0000826600.538.616
Manihot esculentacassava4.1_004404m.486.565cassava4.1_003698m.530.607
Medicago truncatulaMedtr4g074960.1.571.649
Mimulus guttatusmgv1a003302m.501.580
Oryza sativaLOC_Os01g12070.1.544.625LOC_Os01g12030.1.543.620LOC_Os04g57860.1.531.610LOC_Os05g12150.1.535.613
Panicum virgatumPavirv00000152m.548.625Pavirv00066185m.348.426Pavirv00000772m.535.612Pavirv00030375m.537.614Pavirv00029375m.528.607
Physcomitrella patensPp1s176_127V6.1.544.623
Phaseolus vulgarisPhvul.011G030300.1.567.645Phvul.002G297600.1.530.607
Picea abiesMA_895058g0010MA_10437098g0010.516.596MA_127108g0010.524.603MA_42717g0010.527.604MA_10241783g0010.543.621
MA_19509g0020.547.626
Populus trichocarpaPotri.003G139600.1.530.607Potri.001G092200.1.530.607Potri.001G092200.5.285.362Potri.007G071200.1.520.599Potri.007G071200.2.519.598
Potri.001G092200.4.375.452
Prunus persicappa002939m.528.605ppa022524m.499.578
Ricinus communis29675.m000388.528.607
Setaria italicaSi000642m.549.626Si021474m.530.607Si021476m.528.606
Selaginella moellendorffii234652.525.60399802.550.630
Sorghum bicolorSb09g006670.1.535.612Sb03g001560.1.561.639Sb06g032760.1.534.615
Thellungiella halophilaThhalv10023353m.527.604Thhalv10011318m.534.613Thhalv10028514m.535.612
Vitis viniferaGSVIVT01019523001.537.614GSVIVT01012043001.524.602
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)