y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.003G078800.1
FamilyCBM53
Protein PropertiesLength: 1088 Molecular Weight: 124755 Isoelectric Point: 7.5591
ChromosomeChromosome/Scaffold: 03 Start: 12346797 End: 12356882
Descriptionstarch synthase 3
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM531982833.1e-31
  GQDIEVFLNRNLSTLCNEPNVLVKGAFNDWRWKLFTVRLNKTDQLNGDWWSCKLHVPREAYKVDFVFFNGENVYDNNDKRDFSIPV
CBM533774632.1e-31
  VRLYYNRKSGPLANAQEVWLHGGHNNWKDKLSLVKRLVKCSKDGDWWCAHVVILEQAVVLDWVFANGPPGNASEYDNNNHKDFHTIV
CBM535366249.2e-32
  GSTITVFYNPRNTNLNGKPDVWFKHSFNRWTHRNGLFPPQKMLSSKNDTYVKVSVKVPLDAYMIDFVFSEKKDGGIFDNNNTMDYHIPV
GT563510780
  HIVHIAVEMAPIAKVGGLGDVVTSLSRAIQDLDHRVDIILPKYDCLNLNNVENFQYHKNYFWNGTEIKVWHGKVEGLSVYFLEPQNEFFRVGRVYGCAND
  AKRFGFFCHAALEYLFQNGFHPDIIHCHDWSSAPVAWLCKEQYTHCSLSKAGIVFTIHNLEFGAQLIGKAMAYTNMATTVSPTYSREVYENSAIAPHRHK
  FRGILNGIDLDIWDPFNDKFIPMSYTSKNVVEGKKAAKEALQQKLGLRKVDLPLLGVISRLTNQKGIDLIRHAIYRTLERGGQVVLLGSAPDPRIQNEFE
  NLANELHSLHHDRVRLCLIYDEPLSHLIYAGADFIGVPSIFEPCGLTQLVAMRYGSIPIVRKTGGLYDTVFDVDDDKDRAHAEYLKPNGFSFDGANAPGV
  DYALNRAISRWYDDRDWFNTLCKTVMEQDWSWNRPALHYLELYH
Full Sequence
Protein Sequence     Length: 1088     Download
MGMPLLLNCK TVFTNGRTCF GAGLFSPTTA QTNQSVKTGR HSIGIHACAD FSSRRQKKIF    60
IAMPKSYGFD SKGFVVIPAV ETSNLVGKDE NVYIVHKQDN VDTSNMGNVE YLNENHGKII    120
TIVEESDVNG SDNKVINREV VIGRINYDND DILDKETSQL LKLQLEESFK RQEIVRIAKE    180
NVSLHNKLFV YPPVVKPGQD IEVFLNRNLS TLCNEPNVLV KGAFNDWRWK LFTVRLNKTD    240
QLNGDWWSCK LHVPREAYKV DFVFFNGENV YDNNDKRDFS IPVDGGIDAS EFENFLLEEK    300
RIELERLAKE EAEKEEEEKK KRKMELEKVG RDEDRSMARA EVEKKKKLLQ ELTKNAVKCI    360
ENVWYMEPSE FKEKNLVRLY YNRKSGPLAN AQEVWLHGGH NNWKDKLSLV KRLVKCSKDG    420
DWWCAHVVIL EQAVVLDWVF ANGPPGNASE YDNNNHKDFH TIVTNKGMPN KETWISEEEK    480
IYIKLQEKRR LREEAALVKV EETTRLKAEI KKKTLQRHLL SQKHIVFTEP LHVQAGSTIT    540
VFYNPRNTNL NGKPDVWFKH SFNRWTHRNG LFPPQKMLSS KNDTYVKVSV KVPLDAYMID    600
FVFSEKKDGG IFDNNNTMDY HIPVLGSTVK ETPMHIVHIA VEMAPIAKVG GLGDVVTSLS    660
RAIQDLDHRV DIILPKYDCL NLNNVENFQY HKNYFWNGTE IKVWHGKVEG LSVYFLEPQN    720
EFFRVGRVYG CANDAKRFGF FCHAALEYLF QNGFHPDIIH CHDWSSAPVA WLCKEQYTHC    780
SLSKAGIVFT IHNLEFGAQL IGKAMAYTNM ATTVSPTYSR EVYENSAIAP HRHKFRGILN    840
GIDLDIWDPF NDKFIPMSYT SKNVVEGKKA AKEALQQKLG LRKVDLPLLG VISRLTNQKG    900
IDLIRHAIYR TLERGGQVVL LGSAPDPRIQ NEFENLANEL HSLHHDRVRL CLIYDEPLSH    960
LIYAGADFIG VPSIFEPCGL TQLVAMRYGS IPIVRKTGGL YDTVFDVDDD KDRAHAEYLK    1020
PNGFSFDGAN APGVDYALNR AISRWYDDRD WFNTLCKTVM EQDWSWNRPA LHYLELYHVA    1080
RNASRCS*                                                             1140
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02939PLN029392.0e-1336251081512+
TIGR02095glgA3.0e-1456341078486+
PRK00654glgA5.0e-1496341078480+
cd03791GT1_Glycogen_synthase_DULL1_like1.0e-1586351078488+
PLN02316PLN0231606110811037+
Gene Ontology
GO TermDescription
GO:0009058biosynthetic process
GO:2001070starch binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACT09059.1010510812431227starch synthase III precursor [Solanum lycopersicum]
DDBJBAF49176.101108011161starch synthase III [Phaseolus vulgaris]
EMBLCAB40374.1015010802131143Starch synthase isoform SS III [Vigna unguiculata]
RefSeqXP_002269011.10271081721139PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002518476.10861081791057starch synthase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3d1j_A063410781474A Chain A, Crystal Structure Of E.Coli Gs Mutant Dmgs(C7s;c40
PDB3guh_A063410781474A Chain A, Crystal Structure Of E.Coli Gs Mutant Dmgs(C7s;c40
PDB2r4u_A063410781474A Chain A, Crystal Structure Of E.Coli Gs Mutant Dmgs(C7s;c40
PDB2r4t_A063410781474A Chain A, Crystal Structure Of E.Coli Gs Mutant Dmgs(C7s;c40
PDB2qzs_A063410781474A Chain A, Crystal Structure Of Wild-Type E.Coli Gs In Complex With Adp And Glucose(Wtgsb)
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7780037181498650
HO79475857051310810
HO65139241167110810
CK2479293146209330
HO7947581051882870.0003
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_005_00047.2.247.331Aquca_005_00047.2.247.331Aquca_005_00047.2.247.331Aquca_005_00047.1.247.331Aquca_005_00047.1.247.331
Aquca_005_00047.1.247.331Aquca_005_00047.1.423.513Aquca_005_00047.1.423.513Aquca_005_00047.1.423.513Aquca_005_00047.2.581.669
Aquca_005_00047.2.581.669Aquca_005_00047.2.581.669Aquca_005_00047.1.585.673Aquca_005_00047.1.585.673Aquca_005_00047.1.585.673
Aquca_005_00047.2.423.509Aquca_005_00047.2.423.509Aquca_005_00047.2.423.509
Arabidopsis lyrata312200.125.208312200.125.208312200.125.208312200.474.562312200.474.562
312200.474.562312200.300.401312200.300.401312200.300.401
Arabidopsis thalianaAT1G11720.2.206.289AT1G11720.2.206.289AT1G11720.2.206.289AT1G11720.1.154.237AT1G11720.1.154.237
AT1G11720.1.154.237AT1G11720.2.381.475AT1G11720.2.381.475AT1G11720.2.381.475AT1G11720.1.329.423
AT1G11720.1.329.423AT1G11720.1.329.423AT1G11720.2.548.636AT1G11720.2.548.636AT1G11720.2.548.636
AT1G11720.1.496.584AT1G11720.1.496.584AT1G11720.1.496.584
Brachypodium distachyonBradi5g22310.1.403.486Bradi5g22310.1.403.486Bradi5g22310.1.403.486Bradi3g15027.1.835.918Bradi3g15027.1.835.918
Bradi3g15027.1.835.918Bradi5g22310.1.577.667Bradi5g22310.1.577.667Bradi5g22310.1.577.667Bradi5g22310.1.739.827
Bradi5g22310.1.739.827Bradi5g22310.1.739.827
Brassica rapaBra016818.430.514Bra016818.430.514Bra016818.430.514Bra019836.120.208Bra016818.605.694
Bra016818.605.694Bra016818.605.694Bra016818.767.855Bra016818.767.855Bra016818.767.855
Carica papayaevm.model.supercontig_152.17.311.394evm.model.supercontig_152.17.311.394evm.model.supercontig_152.17.311.394evm.model.supercontig_152.17.486.575evm.model.supercontig_152.17.486.575
evm.model.supercontig_152.17.486.575evm.model.supercontig_152.17.647.735evm.model.supercontig_152.17.647.735evm.model.supercontig_152.17.647.735
Capsella rubellaCarubv10011175m.206.289Carubv10011175m.206.289Carubv10011175m.206.289Carubv10011175m.381.474Carubv10011175m.381.474
Carubv10011175m.381.474Carubv10011175m.547.635Carubv10011175m.547.635Carubv10011175m.547.635
Chlamydomonas reinhardtiiCre06.g282000.t2.1.660.749Cre06.g282000.t2.1.660.749Cre06.g282000.t1.3.696.785Cre06.g282000.t1.3.696.785Cre06.g282000.t2.1.308.399
Cre06.g282000.t2.1.308.399Cre06.g282000.t1.3.344.435Cre06.g282000.t1.3.344.435
Citrus clementinaCiclev10014319m.155.243Ciclev10014319m.155.243
Citrus sinensisorange1.1g046057m.276.359orange1.1g046057m.276.359orange1.1g046057m.276.359orange1.1g046057m.452.540orange1.1g046057m.452.540
orange1.1g046057m.452.540orange1.1g046057m.612.700orange1.1g046057m.612.700orange1.1g046057m.612.700
Cucumis sativusCucsa.085800.2.269.352Cucsa.085800.2.269.352Cucsa.085800.2.269.352Cucsa.085800.1.269.352Cucsa.085800.1.269.352
Cucsa.085800.1.269.352Cucsa.085800.2.443.534Cucsa.085800.2.443.534Cucsa.085800.2.443.534Cucsa.085800.1.443.534
Cucsa.085800.1.443.534Cucsa.085800.1.443.534Cucsa.085800.2.607.694Cucsa.085800.2.607.694Cucsa.085800.2.607.694
Cucsa.085800.1.607.694Cucsa.085800.1.607.694Cucsa.085800.1.607.694
Eucalyptus grandisEucgr.D01324.4.304.386Eucgr.D01324.4.304.386Eucgr.D01324.4.304.386Eucgr.D01324.3.304.386Eucgr.D01324.3.304.386
Eucgr.D01324.3.304.386Eucgr.D01324.2.304.386Eucgr.D01324.2.304.386Eucgr.D01324.2.304.386Eucgr.D01324.1.309.391
Eucgr.D01324.1.309.391Eucgr.D01324.1.309.391Eucgr.D01324.4.478.567Eucgr.D01324.4.478.567Eucgr.D01324.4.478.567
Eucgr.D01324.3.478.567Eucgr.D01324.3.478.567Eucgr.D01324.3.478.567Eucgr.D01324.2.478.567Eucgr.D01324.2.478.567
Eucgr.D01324.2.478.567Eucgr.D01324.1.483.572Eucgr.D01324.1.483.572Eucgr.D01324.1.483.572Eucgr.D01324.4.639.727
Eucgr.D01324.4.639.727Eucgr.D01324.4.639.727Eucgr.D01324.3.639.727Eucgr.D01324.3.639.727Eucgr.D01324.3.639.727
Eucgr.D01324.2.639.727Eucgr.D01324.2.639.727Eucgr.D01324.2.639.727Eucgr.D01324.1.644.732Eucgr.D01324.1.644.732
Eucgr.D01324.1.644.732
Fragaria vescamrna19625.1-v1.0-hybrid.209.292mrna19625.1-v1.0-hybrid.209.292mrna19625.1-v1.0-hybrid.209.292mrna19625.1-v1.0-hybrid.384.473mrna19625.1-v1.0-hybrid.384.473
mrna19625.1-v1.0-hybrid.384.473mrna19625.1-v1.0-hybrid.546.633mrna19625.1-v1.0-hybrid.546.633mrna19625.1-v1.0-hybrid.546.633
Glycine maxGlyma13g27480.1.265.348Glyma13g27480.1.265.348Glyma13g27480.1.265.348Glyma15g11500.1.282.365Glyma15g11500.1.282.365
Glyma15g11500.1.282.365Glyma07g39040.2.196.281Glyma07g39040.2.196.281Glyma07g39040.2.196.281Glyma15g11500.1.459.546
Glyma15g11500.1.459.546Glyma15g11500.1.459.546Glyma13g27480.1.442.529Glyma13g27480.1.442.529Glyma13g27480.1.442.529
Glyma07g39040.2.374.462Glyma07g39040.2.374.462Glyma07g39040.2.374.462Glyma15g11500.1.618.706Glyma15g11500.1.618.706
Glyma15g11500.1.618.706Glyma07g39040.2.534.622Glyma07g39040.2.534.622Glyma07g39040.2.534.622Glyma13g27480.1.601.689
Glyma13g27480.1.601.689Glyma13g27480.1.601.689
Gossypium raimondiiGorai.011G013800.6.270.352Gorai.011G013800.6.270.352Gorai.011G013800.6.270.352Gorai.011G013800.5.192.274Gorai.011G013800.5.192.274
Gorai.011G013800.5.192.274Gorai.011G013800.4.192.274Gorai.011G013800.4.192.274Gorai.011G013800.4.192.274Gorai.011G013800.3.192.274
Gorai.011G013800.3.192.274Gorai.011G013800.3.192.274Gorai.011G013800.2.270.352Gorai.011G013800.2.270.352Gorai.011G013800.2.270.352
Gorai.011G013800.1.270.352Gorai.011G013800.1.270.352Gorai.011G013800.1.270.352Gorai.009G178700.6.279.362Gorai.009G178700.6.279.362
Gorai.009G178700.6.279.362Gorai.009G178700.5.279.362Gorai.009G178700.5.279.362Gorai.009G178700.5.279.362Gorai.009G178700.4.157.240
Gorai.009G178700.4.157.240Gorai.009G178700.4.157.240Gorai.009G178700.3.279.362Gorai.009G178700.3.279.362Gorai.009G178700.3.279.362
Gorai.009G178700.2.279.362Gorai.009G178700.2.279.362Gorai.009G178700.2.279.362Gorai.009G178700.1.279.362Gorai.009G178700.1.279.362
Gorai.009G178700.1.279.362Gorai.011G013800.6.444.533Gorai.011G013800.6.444.533Gorai.011G013800.6.444.533Gorai.011G013800.5.366.455
Gorai.011G013800.5.366.455Gorai.011G013800.5.366.455Gorai.011G013800.4.366.455Gorai.011G013800.4.366.455Gorai.011G013800.4.366.455
Gorai.011G013800.3.366.455Gorai.011G013800.3.366.455Gorai.011G013800.3.366.455Gorai.011G013800.2.444.533Gorai.011G013800.2.444.533
Gorai.011G013800.2.444.533Gorai.011G013800.1.444.533Gorai.011G013800.1.444.533Gorai.011G013800.1.444.533Gorai.009G178700.6.454.543
Gorai.009G178700.6.454.543Gorai.009G178700.6.454.543Gorai.009G178700.5.454.543Gorai.009G178700.5.454.543Gorai.009G178700.5.454.543
Gorai.009G178700.4.332.421Gorai.009G178700.4.332.421Gorai.009G178700.4.332.421Gorai.009G178700.3.454.543Gorai.009G178700.3.454.543
Gorai.009G178700.3.454.543Gorai.009G178700.2.454.543Gorai.009G178700.2.454.543Gorai.009G178700.2.454.543Gorai.009G178700.1.454.543
Gorai.009G178700.1.454.543Gorai.009G178700.1.454.543Gorai.009G178700.6.615.703Gorai.009G178700.6.615.703Gorai.009G178700.6.615.703
Gorai.009G178700.5.615.703Gorai.009G178700.5.615.703Gorai.009G178700.5.615.703Gorai.009G178700.4.493.581Gorai.009G178700.4.493.581
Gorai.009G178700.4.493.581Gorai.009G178700.3.615.703Gorai.009G178700.3.615.703Gorai.009G178700.3.615.703Gorai.009G178700.2.615.703
Gorai.009G178700.2.615.703Gorai.009G178700.2.615.703Gorai.009G178700.1.615.703Gorai.009G178700.1.615.703Gorai.009G178700.1.615.703
Gorai.011G013800.6.606.693Gorai.011G013800.6.606.693Gorai.011G013800.6.606.693Gorai.011G013800.5.528.615Gorai.011G013800.5.528.615
Gorai.011G013800.5.528.615Gorai.011G013800.4.528.615Gorai.011G013800.4.528.615Gorai.011G013800.4.528.615Gorai.011G013800.3.528.615
Gorai.011G013800.3.528.615Gorai.011G013800.3.528.615Gorai.011G013800.2.606.693Gorai.011G013800.2.606.693Gorai.011G013800.2.606.693
Gorai.011G013800.1.606.693Gorai.011G013800.1.606.693Gorai.011G013800.1.606.693
Linum usitatissimumLus10020044.225.308Lus10020044.225.308Lus10020044.225.308Lus10006780.228.311Lus10006780.228.311
Lus10006780.228.311Lus10006780.565.653Lus10006780.565.653Lus10006780.565.653Lus10020044.562.650
Lus10020044.562.650Lus10020044.562.650Lus10006780.404.493Lus10006780.404.493Lus10006780.404.493
Lus10020044.401.490Lus10020044.401.490Lus10020044.401.490
Malus domesticaMDP0000191201.257.340MDP0000191201.257.340MDP0000191201.257.340MDP0000151462.257.340MDP0000151462.257.340
MDP0000151462.257.340MDP0000252413.204.287MDP0000252413.204.287MDP0000191201.433.521MDP0000191201.433.521
MDP0000191201.433.521MDP0000151462.433.521MDP0000151462.433.521MDP0000151462.433.521MDP0000585054.156.244
MDP0000585054.156.244MDP0000252413.380.468MDP0000252413.380.468MDP0000191201.594.681MDP0000191201.594.681
MDP0000191201.594.681MDP0000151462.594.681MDP0000151462.594.681MDP0000151462.594.681
Manihot esculentacassava4.1_000528m.264.347cassava4.1_000528m.264.347cassava4.1_000528m.264.347cassava4.1_001042m.91.174cassava4.1_001042m.91.174
cassava4.1_001042m.91.174cassava4.1_000528m.440.528cassava4.1_000528m.440.528cassava4.1_000528m.440.528cassava4.1_001042m.261.348
cassava4.1_001042m.261.348cassava4.1_001042m.261.348cassava4.1_001042m.421.508cassava4.1_001042m.421.508cassava4.1_001042m.421.508
cassava4.1_000528m.601.688cassava4.1_000528m.601.688cassava4.1_000528m.601.688
Mimulus guttatusmgv1a000364m.363.446mgv1a000364m.363.446mgv1a000364m.670.758mgv1a000364m.670.758
Oryza sativaLOC_Os08g09230.2.906.989LOC_Os08g09230.2.906.989LOC_Os08g09230.2.906.989LOC_Os08g09230.1.906.989LOC_Os08g09230.1.906.989
LOC_Os08g09230.1.906.989LOC_Os04g53310.1.334.417LOC_Os04g53310.1.334.417LOC_Os04g53310.1.334.417LOC_Os04g53310.1.508.598
LOC_Os04g53310.1.508.598LOC_Os04g53310.1.508.598LOC_Os04g53310.1.670.758LOC_Os04g53310.1.670.758LOC_Os04g53310.1.670.758
Panicum virgatumPavirv00054440m.151.234Pavirv00054440m.151.234Pavirv00054440m.151.234Pavirv00009477m.238.321Pavirv00009477m.238.321
Pavirv00009477m.238.321Pavirv00019877m.488.571Pavirv00019877m.488.571Pavirv00019877m.488.571Pavirv00009007m.640.723
Pavirv00009007m.640.723Pavirv00009007m.640.723Pavirv00069992m.620.703Pavirv00069992m.620.703Pavirv00069992m.620.703
Pavirv00054440m.325.415Pavirv00054440m.325.415Pavirv00054440m.325.415Pavirv00054440m.487.575Pavirv00054440m.487.575
Pavirv00054440m.487.575Pavirv00069992m.795.882Pavirv00069992m.795.882Pavirv00069992m.795.882Pavirv00009477m.412.502
Pavirv00009477m.412.502Pavirv00009477m.412.502Pavirv00009477m.574.662Pavirv00009477m.574.662Pavirv00009477m.574.662
Pavirv00019877m.663.750Pavirv00019877m.663.750Pavirv00019877m.663.750Pavirv00019877m.824.912Pavirv00019877m.824.912
Pavirv00019877m.824.912Pavirv00009007m.815.902Pavirv00009007m.815.902Pavirv00009007m.815.902
Phaseolus vulgarisPhvul.011G151400.1.281.364Phvul.011G151400.1.281.364Phvul.011G151400.1.281.364Phvul.003G078800.1.198.283Phvul.003G078800.1.198.283
Phvul.003G078800.1.198.283Phvul.011G151400.1.458.545Phvul.011G151400.1.458.545Phvul.011G151400.1.458.545Phvul.003G078800.1.377.463
Phvul.003G078800.1.377.463Phvul.003G078800.1.377.463Phvul.011G151400.1.617.705Phvul.011G151400.1.617.705Phvul.011G151400.1.617.705
Phvul.003G078800.1.536.624Phvul.003G078800.1.536.624Phvul.003G078800.1.536.624
Picea abiesMA_10437241g0010.202.286MA_10437241g0010.202.286MA_10437241g0010.202.286MA_10437241g0010.377.467MA_10437241g0010.377.467
MA_10437241g0010.377.467MA_10437241g0010.540.629MA_10437241g0010.540.629MA_10437241g0010.540.629
Populus trichocarpaPotri.004G014100.2.162.245Potri.004G014100.2.162.245Potri.004G014100.2.162.245Potri.004G014100.1.281.364Potri.004G014100.1.281.364
Potri.004G014100.1.281.364Potri.004G014100.2.337.426Potri.004G014100.2.337.426Potri.004G014100.2.337.426Potri.004G014100.1.456.545
Potri.004G014100.1.456.545Potri.004G014100.1.456.545Potri.004G014100.2.498.586Potri.004G014100.2.498.586Potri.004G014100.2.498.586
Potri.004G014100.1.617.705Potri.004G014100.1.617.705Potri.004G014100.1.617.705
Prunus persicappa001074m.35.118ppa001074m.35.118ppa001074m.35.118ppa001074m.211.299ppa001074m.211.299
ppa001074m.211.299ppa001074m.372.460ppa001074m.372.460ppa001074m.372.460
Ricinus communis29842.m003588.184.26729842.m003588.184.26729842.m003588.184.26729842.m003588.389.47729842.m003588.389.477
29842.m003588.389.47729842.m003588.550.63729842.m003588.550.63729842.m003588.550.637
Setaria italicaSi013121m.535.618Si013121m.535.618Si013121m.535.618Si009214m.272.354Si009214m.272.354
Si009214m.272.354Si015393m.625.708Si015393m.625.708Si015393m.625.708Si009214m.445.535
Si009214m.445.535Si009214m.445.535Si009214m.607.695Si009214m.607.695Si009214m.607.695
Si013121m.706.793Si013121m.706.793Si013121m.706.793Si013121m.868.956Si013121m.868.956
Si013121m.868.956Si015393m.801.887Si015393m.801.887Si015393m.801.887
Selaginella moellendorffii154776.15.97154776.15.97154776.15.97154776.189.279154776.189.279
154776.189.279154776.351.441154776.351.441154776.351.441
Sorghum bicolorSb06g029050.1.309.392Sb06g029050.1.309.392Sb06g029050.1.309.392Sb07g005400.1.782.865Sb07g005400.1.782.865
Sb07g005400.1.782.865Sb06g029050.1.483.573Sb06g029050.1.483.573Sb06g029050.1.483.573Sb06g029050.1.645.733
Sb06g029050.1.645.733Sb06g029050.1.645.733
Thellungiella halophilaThhalv10006781m.209.292Thhalv10006781m.209.292Thhalv10006781m.209.292Thhalv10006631m.209.292Thhalv10006631m.209.292
Thhalv10006631m.209.292Thhalv10006781m.384.477Thhalv10006781m.384.477Thhalv10006781m.384.477Thhalv10006631m.384.477
Thhalv10006631m.384.477Thhalv10006631m.384.477Thhalv10006781m.549.638Thhalv10006781m.549.638Thhalv10006781m.549.638
Thhalv10006631m.549.638Thhalv10006631m.549.638Thhalv10006631m.549.638
Vitis viniferaGSVIVT01012723001.340.428GSVIVT01012723001.340.428GSVIVT01012723001.500.588GSVIVT01012723001.500.588
Volvox carteriVocar20002632m.688.777Vocar20002632m.688.777Vocar20002632m.313.404Vocar20002632m.313.404
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)