CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.007G139400.1
FamilyGH13
Protein PropertiesLength: 958 Molecular Weight: 106570 Isoelectric Point: 6.2632
ChromosomeChromosome/Scaffold: 07 Start: 34315056 End: 34334394
Descriptionlimit dextrinase
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH133637642.1e-31
  HLKRLSSAGITHVHLLPSFQFAGVDDQKENWRYVDNSILESLPPDSDQQQALITAIQNFDGYNWGYNPVLWGVPKGSYASNPNGPYRTIEFRKMVKALNH
  IGLRVVLDVVYNHLQGSGPLEEHSVLDKIVPGYYLRRNRDGFIENSTCINNTASEHFMVERLILDDLVHWALNYKIDGFRFDLMGHIMKRTMVKAKTALH
  SLTKEKDGVDGSSIYIYGEGWDFGEVAKNGRGINASQFNLPGTQIGSFNDRIRDAILGGSPFGHPLQQGFVTGLLLQPNGHDHGTEANAKSMLDTSMDHI
  QIGMAANLQDFVLTNCEGEEVKGSEILTYDGTPVAYASCPIETINYVSAHDNETLFDIVSLKTPMDVTVTERCRINHLATSIVALSQGIPFFHSGDEILR
  SK
Full Sequence
Protein Sequence     Length: 958     Download
MLLLASSSSS PSLSLPSLSH LHHSLPSSFP RHSLRLHFPS QATPLHLRTP PPLSCSINAS    60
SSVEQSASLS QMQNSLLYSR AYWVTEFLIA WNVDVANGSS CHLIASKNAS LTIANCQIQG    120
EDLKIELQED RAGLPANVVE KFPHIRGYKA FKLPSTLDVK PLLKSQLAVA IYDSDDKCRN    180
CTGLQLPGVL DELFSYDGPL GALFSEEAVS LYLWAPTAQA VRAYIYKDPS GDDPIEIVCL    240
EEENGVWRTK GRKSWEHCYY VYEVCVYHHS TLRVEKCYAN DPYARGLSSD GGRTFLLNLD    300
SDDLKPDGWD NLANEKPTIH SFTDISIYEM HIRDFSASDL SVQPSFRGGY LAFTLLDSAG    360
VLHLKRLSSA GITHVHLLPS FQFAGVDDQK ENWRYVDNSI LESLPPDSDQ QQALITAIQN    420
FDGYNWGYNP VLWGVPKGSY ASNPNGPYRT IEFRKMVKAL NHIGLRVVLD VVYNHLQGSG    480
PLEEHSVLDK IVPGYYLRRN RDGFIENSTC INNTASEHFM VERLILDDLV HWALNYKIDG    540
FRFDLMGHIM KRTMVKAKTA LHSLTKEKDG VDGSSIYIYG EGWDFGEVAK NGRGINASQF    600
NLPGTQIGSF NDRIRDAILG GSPFGHPLQQ GFVTGLLLQP NGHDHGTEAN AKSMLDTSMD    660
HIQIGMAANL QDFVLTNCEG EEVKGSEILT YDGTPVAYAS CPIETINYVS AHDNETLFDI    720
VSLKTPMDVT VTERCRINHL ATSIVALSQG IPFFHSGDEI LRSKSLDRDS YNSGDWFNRL    780
DFTYNSNNWG VGLPPQEKNE KNWPLMKPRL ANPSFRPEKI HILAAVDNLL NLLRIRYSSP    840
LFRLKTENAI KQRVSFHNTG PSWVCGVIVM SIEDGHDGFP GLSQLDPIYS FIVVVVNASP    900
KEVSFVSPAL QSRSLQLHPI QVSSSDDLVK SSRYETSSGC FVVPQRTTAV FVEPRKT*      960
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG1523PulA4.0e-92192951813+
TIGR02104pulA_typeI2.0e-132191909735+
cd11341AmyAc_Pullulanase_LD-like4.0e-169323788476+
PLN02877PLN02877071955885+
TIGR02103pullul_strch076955915+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAA58803.105395561962pullulanase [Spinacia oleracea]
EMBLCBI31395.102695616955unnamed protein product [Vitis vinifera]
RefSeqXP_002271820.107295623906PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002315334.10689556893predicted protein [Populus trichocarpa]
RefSeqXP_002532780.105295561964pullulanase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4aio_A0799556883A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB2y5e_A0799556883A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB2y4s_A0799556883A Chain A, Barley Limit Dextrinase In Complex With Beta-Cyclodextrin
PDB2fhf_A01389552321070A Chain A, Barley Limit Dextrinase In Complex With Beta-Cyclodextrin
PDB2fhc_A01389552321070A Chain A, Barley Limit Dextrinase In Complex With Beta-Cyclodextrin
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO1283442873916770
GO8722433415819210
EH7738472826128930
DV1354572645708330
AM7334102876329180
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_030_00024.1
Arabidopsis lyrata487216
Arabidopsis thalianaAT5G04360.1
Brachypodium distachyonBradi5g00540.2Bradi5g00540.1
Brassica rapaBra009461
Carica papayaevm.model.supercontig_53.158
Capsella rubellaCarubv10000153m
Chlamydomonas reinhardtiiCre11.g476650.t1.3
Citrus clementinaCiclev10031035m
Citrus sinensisorange1.1g002079morange1.1g002161morange1.1g002787m
Cucumis sativusCucsa.308730.1
Eucalyptus grandisEucgr.G02746.1Eucgr.G02746.2
Fragaria vescamrna23425.1-v1.0-hybrid
Glycine maxGlyma10g34080.1
Gossypium raimondiiGorai.009G305300.12Gorai.009G305300.11Gorai.009G305300.1Gorai.009G305300.10Gorai.009G305300.2
Gorai.009G305300.3Gorai.009G305300.4Gorai.009G305300.5Gorai.009G305300.6Gorai.009G305300.7
Gorai.009G305300.9Gorai.009G305300.8
Linum usitatissimumLus10038675
Malus domesticaMDP0000142103
Manihot esculentacassava4.1_004771m
Mimulus guttatusmgv1a001246m
Physcomitrella patensPp1s142_79V6.1.481.888
Populus trichocarpaPotri.010G229300.4Potri.010G229300.1Potri.010G229300.2Potri.010G229300.3
Prunus persicappa000905m
Ricinus communis29475.m000230
Setaria italicaSi011852m
Selaginella moellendorffii165275
Sorghum bicolorSb06g001540.1
Thellungiella halophilaThhalv10012585m
Vitis viniferaGSVIVT01016183001
Volvox carteriVocar20014607m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny