y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.008G142200.1
FamilyCBM43
Protein PropertiesLength: 466 Molecular Weight: 51393.1 Isoelectric Point: 9.8312
ChromosomeChromosome/Scaffold: 08 Start: 25515298 End: 25518005
DescriptionO-Glycosyl hydrolases family 17 protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM433764598.8e-27
  WCVAARRDNVTELAAALSYACSQGNGTCDPIQTRGKCFKPGSVFWHASYAFSAYWAQFKKIGATCYFNGLATQTAKDPSYGSCK
GH17293490
  GICYGQLGDNLPPARQSVSHLTSLHAKRVKLYDANPAILHALQHTRLQVSVMVPNDLIMNISSNQTLADKWVSSNVAAFLPNTRIRYILVGNEIISSTTN
  ATWRHVVPAMRRIKHALKSLGIRKVKVGTSSAMDVLQTSFPPSNAAFREDIAVPVMKPMLKFLNRTKSFFFLDVYPFFAWSSDPVNINLDYALFESNNIT
  VTDPGSGLVYTNLFDQMVDAVYFAMEKLGFPGIRIFVAETGWPNGGDLDQIGANVYNAATYNRNFIKKVTRKPRVGTPARPGSLLPSFLFALFNENQKSG
  PGTERHFGLLHPNGSRVFDID
Full Sequence
Protein Sequence     Length: 466     Download
MAMLLFIPLL LSFILLFSIS TATFSPQPGI CYGQLGDNLP PARQSVSHLT SLHAKRVKLY    60
DANPAILHAL QHTRLQVSVM VPNDLIMNIS SNQTLADKWV SSNVAAFLPN TRIRYILVGN    120
EIISSTTNAT WRHVVPAMRR IKHALKSLGI RKVKVGTSSA MDVLQTSFPP SNAAFREDIA    180
VPVMKPMLKF LNRTKSFFFL DVYPFFAWSS DPVNINLDYA LFESNNITVT DPGSGLVYTN    240
LFDQMVDAVY FAMEKLGFPG IRIFVAETGW PNGGDLDQIG ANVYNAATYN RNFIKKVTRK    300
PRVGTPARPG SLLPSFLFAL FNENQKSGPG TERHFGLLHP NGSRVFDIDL SGKTPESDFQ    360
PLPAPENNEK FKGKIWCVAA RRDNVTELAA ALSYACSQGN GTCDPIQTRG KCFKPGSVFW    420
HASYAFSAYW AQFKKIGATC YFNGLATQTA KDPSYGSCKF PSVTL*                   480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07983X89.0e-1737644779+
smart00768X85.0e-3237646087+
pfam00332Glyco_hydro_171.0e-11029349322+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAF20214.101746514440AC012395_1 putative beta-1,3-glucanase precursor [Arabidopsis thaliana]
GenBankAAM65039.101746514460putative glucan endo-1-3-beta-glucosidase [Arabidopsis thaliana]
EMBLCBI39470.101346514467unnamed protein product [Vitis vinifera]
RefSeqNP_683538.101746514460glycosyl hydrolase family 17 protein [Arabidopsis thaliana]
RefSeqXP_002334812.1014651465predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2cyg_A0293502312A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_D0293513316A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_C0293513316A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_B0293513316A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_A0293513316A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
Transmembrane Domains
StartEnd
224
Signal Peptide
Cleavage Site
22
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX2913573591004560
EX2795003141034150
DT5722513021124130
FG8793732252424660
EX279500194194370.35
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_034_00089.1.396.481Aquca_009_00879.1.376.461
Arabidopsis lyrata317589.371.454479892.387.470493503.389.472
Arabidopsis thalianaAT3G07320.1.371.454AT3G23770.1.387.470AT4G14080.1.389.472
Brachypodium distachyonBradi3g40907.1.397.480Bradi3g40907.1.397.480Bradi4g34390.1.385.471Bradi5g12137.1.382.465Bradi3g40907.1.501.584
Bradi3g40907.1.501.584
Brassica rapaBra001918.391.473Bra028343.387.470Bra037057.390.473Bra014979.389.472Bra001245.371.450
Bra032758.391.474Bra029639.371.454Bra038969.390.468
Carica papayaevm.model.supercontig_8.110.373.456evm.model.supercontig_157.32.380.459
Capsella rubellaCarubv10006945m.389.472Carubv10015952m.387.470Carubv10013655m.371.454
Citrus clementinaCiclev10031440m.377.460Ciclev10004917m.379.458
Citrus sinensisorange1.1g012660m.379.457
Cucumis sativusCucsa.251950.1.378.460Cucsa.149990.1.374.457
Eucalyptus grandisEucgr.K02113.2.377.460Eucgr.K02113.1.377.460Eucgr.H02646.1.352.434
Fragaria vescamrna17437.1-v1.0-hybrid.483.561mrna17436.1-v1.0-hybrid.347.425
Glycine maxGlyma18g32840.1.378.461Glyma08g46110.1.378.461
Gossypium raimondiiGorai.005G026800.1.373.456Gorai.001G230200.2.372.451Gorai.006G224700.1.373.456Gorai.001G230200.3.297.380Gorai.001G230200.1.372.455
Gorai.N004800.1.375.458
Linum usitatissimumLus10008881.379.462Lus10023226.358.441Lus10001740Lus10025892.333.417Lus10038211.374.458
Malus domesticaMDP0000317729.374.452MDP0000283768.334.416MDP0000235663.374.452
Manihot esculentacassava4.1_023781m.375.458cassava4.1_024973m.361.439cassava4.1_007070m.376.459
Medicago truncatulaMedtr8g012400.1.374.457
Mimulus guttatusmgv1a005774m.382.465mgv1a006049m.370.453
Oryza sativaLOC_Os09g32550.2.384.471LOC_Os09g32550.1.387.474LOC_Os03g62860.1.382.467LOC_Os08g41410.1.385.467
Panicum virgatumPavirv00066351m.389.471Pavirv00044843m.360.447Pavirv00008164m.395.481Pavirv00006057m.374.460Pavirv00059046m.386.467
Phaseolus vulgarisPhvul.010G023800.1.372.455Phvul.008G142200.1.376.459
Picea abiesMA_907g0010MA_2025g0010.240.322MA_10426132g0010.130.212MA_10434158g0010.296.378MA_228746g0010.274.356
Populus trichocarpaPotri.002G247900.2.376.454Potri.002G247900.1.376.459Potri.002G247800.1.376.459Potri.017G060300.1.377.460Potri.001G321900.1.327.410
Prunus persicappa006984m.298.381ppa016789m.361.446
Ricinus communis28401.m000073.298.381
Setaria italicaSi029669m.389.476Si015679m.397.484
Selaginella moellendorffii85067.362.443
Sorghum bicolorSb01g001430.1.390.476Sb02g029080.1.388.475Sb07g026540.1.393.478
Thellungiella halophilaThhalv10002513m.385.468Thhalv10025081m.390.473Thhalv10020660m.380.463Thhalv10020663m.380.463
Vitis viniferaGSVIVT01031619001.286.369GSVIVT01031698001.378.461
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)