y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.009G182100.1
FamilyGH89
Protein PropertiesLength: 778 Molecular Weight: 89762.4 Isoelectric Point: 5.6559
ChromosomeChromosome/Scaffold: 09 Start: 26831907 End: 26845064
Descriptionalpha-N-acetylglucosaminidase family / NAGLU family
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH89924350
  PQILIEGTTGVDIVSGLHWYLKHWCGSHISWDKTGGSQLFSLPNVGFLPRIPHSAGISVQRPIPWSYYQNAVTSSYSFAWWDWERWEKEIDWMALQGVNL
  PLAFTGQEAIWQKVFQEKFNMSMSDLDDFFGGPAFLAWSRMGNLHGWGGPLPQSWFDKQLILQKKILARMYELGMTPVLPAFSGNVPAALKYIFPSAKIT
  RLGNWFSVKNDLKWCCTYLLDATDPLFIEIGKAFIEKQLQEYGRTGHIYNCDTFDENTPPIDDPEYISSLGAATFKGMQSGDDDAVWLMQGWLFSYDPFW
  RPPQMKALLHSVPLGKLVVLDLFAEVKPIWVTSEQFYGVPYIWK
GH894367600
  VGVGMSMEGIEQNPIVYDLMSEMAFQQKKIDVKAWVDMYSTRRYGKSLPLIQEGWNVLYHTIYNCTDGAYDKNRDVIVAFPDVDPSLISVQYDQSHHYYR
  PSGTVIKEITDPFDRPHLWYSTSEVIYALELFITIGDELSRSKTYRYDLVDLTRQVLAKYANELFFKVIEAYKSHDVHGMTLLSQRFLDLVEDLDTLLAC
  HDGFLLGPWLESAKQLAQNEEQERQFEWNARTQITMWFDNTKEEASLLRDYGNKYWSGLLHDYYGPRAAIYFKYLRESLERGEDFKLIEWRREWIKLTNE
  WQKSRNTFPVESKGDALNTSRWLFN
Full Sequence
Protein Sequence     Length: 778     Download
MNLPFPAIFL IFIFSIPSSS TAATGVNAIS RLIEIQDRER APPSVQEAAA RGVLLRLLPS    60
QSSSFQFRIK QCGGEYCFVI KNHPSFATPG DPQILIEGTT GVDIVSGLHW YLKHWCGSHI    120
SWDKTGGSQL FSLPNVGFLP RIPHSAGISV QRPIPWSYYQ NAVTSSYSFA WWDWERWEKE    180
IDWMALQGVN LPLAFTGQEA IWQKVFQEKF NMSMSDLDDF FGGPAFLAWS RMGNLHGWGG    240
PLPQSWFDKQ LILQKKILAR MYELGMTPVL PAFSGNVPAA LKYIFPSAKI TRLGNWFSVK    300
NDLKWCCTYL LDATDPLFIE IGKAFIEKQL QEYGRTGHIY NCDTFDENTP PIDDPEYISS    360
LGAATFKGMQ SGDDDAVWLM QGWLFSYDPF WRPPQMKALL HSVPLGKLVV LDLFAEVKPI    420
WVTSEQFYGV PYIWKVGVGM SMEGIEQNPI VYDLMSEMAF QQKKIDVKAW VDMYSTRRYG    480
KSLPLIQEGW NVLYHTIYNC TDGAYDKNRD VIVAFPDVDP SLISVQYDQS HHYYRPSGTV    540
IKEITDPFDR PHLWYSTSEV IYALELFITI GDELSRSKTY RYDLVDLTRQ VLAKYANELF    600
FKVIEAYKSH DVHGMTLLSQ RFLDLVEDLD TLLACHDGFL LGPWLESAKQ LAQNEEQERQ    660
FEWNARTQIT MWFDNTKEEA SLLRDYGNKY WSGLLHDYYG PRAAIYFKYL RESLERGEDF    720
KLIEWRREWI KLTNEWQKSR NTFPVESKGD ALNTSRWLFN KYLNLTNTET KLIEVQR*      780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam12971NAGLU_N1.0e-204614298+
pfam12972NAGLU_C7.0e-97469762294+
pfam05089NAGLU6.0e-160158461337+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEEC78143.102976433808hypothetical protein OsI_17702 [Oryza sativa Indica Group]
GenBankEEE61812.10197643231108hypothetical protein OsJ_16433 [Oryza sativa Japonica Group]
RefSeqXP_002280399.101976321805PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002318632.102176826809predicted protein [Populus trichocarpa]
RefSeqXP_002511461.1037685805alpha-n-acetylglucosaminidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vcc_A065774190888B Chain B, Reassembly And Co-Crystallization Of A Family 9 Processive Endoglucanase From Separately Expressed Gh9 And Cbm3c Modules
PDB2vcb_A065774190888B Chain B, Reassembly And Co-Crystallization Of A Family 9 Processive Endoglucanase From Separately Expressed Gh9 And Cbm3c Modules
PDB2vca_A065774190888B Chain B, Reassembly And Co-Crystallization Of A Family 9 Processive Endoglucanase From Separately Expressed Gh9 And Cbm3c Modules
PDB2vc9_A065774190888A Chain A, Family 89 Glycoside Hydrolase From Clostridium Perfringens In Complex With 2-Acetamido-1,2-Dideoxynojirmycin
PDB4a4a_A065774213911A Chain A, Cpgh89 (E483q, E601q), From Clostridium Perfringens, In Complex With Its Substrate Glcnac-Alpha-1,4-Galactose
Signal Peptide
Cleavage Site
22
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7831284183457290
DY278644330253510
DY267221314253350
CA7844692471063510
DY2672211283164370.000000005
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_057_00157.1Aquca_039_00072.1Aquca_057_00157.2Aquca_057_00157.3Aquca_057_00157.4
Aquca_002_00330.4.155.497Aquca_002_00330.4.155.497Aquca_002_00330.2.100.442Aquca_002_00330.2.100.442Aquca_002_00330.1.155.497
Aquca_002_00330.1.155.497Aquca_002_00330.3.100.434Aquca_002_00330.3.100.434Aquca_002_00330.1.514.887Aquca_002_00330.1.514.887
Aquca_002_00330.3.451.826Aquca_002_00330.3.451.826Aquca_002_00330.2.459.834Aquca_002_00330.2.459.834Aquca_002_00330.4.514.785
Aquca_002_00330.4.514.785
Arabidopsis lyrata488189
Arabidopsis thalianaAT5G13690.1
Brachypodium distachyonBradi1g62007.1Bradi5g24207.1
Brassica rapaBra023429
Carica papayaevm.model.supercontig_125.32evm.model.supercontig_35.39evm.model.supercontig_35.44
Capsella rubellaCarubv10000251m
Citrus clementinaCiclev10030724mCiclev10018883mCiclev10019020mCiclev10019066mCiclev10019065m
Citrus sinensisorange1.1g003545morange1.1g006843morange1.1g006829morange1.1g008173morange1.1g009062m
orange1.1g009057morange1.1g009049morange1.1g012032morange1.1g012026morange1.1g009153m.237.531
orange1.1g009153m.237.531
Cucumis sativusCucsa.128090.1Cucsa.197210.1
Eucalyptus grandisEucgr.B00338.1Eucgr.G03358.1Eucgr.G03358.2Eucgr.B00338.2
Fragaria vescamrna09491.1-v1.0-hybrid.106.845mrna29475.1-v1.0-hybrid
Glycine maxGlyma10g11720.3Glyma06g19791.1.94.437Glyma06g19791.1.94.437Glyma06g19791.1.438.763Glyma06g19791.1.438.763
Gossypium raimondiiGorai.004G170700.1Gorai.004G170700.3Gorai.004G170700.4Gorai.004G170700.2.346.780Gorai.004G170700.2.346.780
Gorai.001G078400.1.96.430Gorai.001G078400.1.96.430Gorai.004G170700.2.108.346Gorai.004G170700.2.108.346Gorai.001G078400.1.466.832
Gorai.001G078400.1.466.832
Linum usitatissimumLus10039598Lus10029494Lus10043468Lus10034116.106.408Lus10034116.106.408
Lus10034116.462.875Lus10034116.462.875
Malus domesticaMDP0000220242MDP0000138607MDP0000208532MDP0000203950MDP0000134637
Manihot esculentacassava4.1_001859mcassava4.1_003710mcassava4.1_022588mcassava4.1_012214m
Medicago truncatulaMedtr3g032980.2.357.804Medtr3g032980.2.357.804Medtr3g032980.1.357.829Medtr3g032980.1.357.829Medtr3g032980.3.95.333
Medtr3g032980.3.95.333Medtr3g032980.2.95.333Medtr3g032980.2.95.333Medtr3g032980.1.95.333Medtr3g032980.1.95.333
Medtr3g032980.3.357.529Medtr3g032980.3.357.529
Mimulus guttatusmgv1a001508mmgv1a018437m
Oryza sativaLOC_Os04g55730.1.99.440LOC_Os04g55730.1.99.440LOC_Os04g55730.1.441.772LOC_Os04g55730.1.441.772
Panicum virgatumPavirv00063217mPavirv00008468mPavirv00041670mPavirv00026596m.238.567Pavirv00026596m.238.567
Physcomitrella patensPp1s329_23V6.1
Phaseolus vulgarisPhvul.005G023300.1Phvul.005G023300.2Phvul.009G182100.1.92.435Phvul.009G182100.1.92.435Phvul.009G182100.2.253.577
Phvul.009G182100.2.253.577Phvul.009G182100.1.436.760Phvul.009G182100.1.436.760
Picea abiesMA_10437144g0010
Populus trichocarpaPotri.009G058100.1Potri.012G075900.1.100.435Potri.012G075900.1.100.435Potri.012G075900.1.436.751Potri.012G075900.1.436.751
Prunus persicappa001555mppa001642m
Ricinus communis30147.m01401129864.m001461
Setaria italicaSi034295mSi009392m.103.444Si009392m.103.444Si009392m.445.774Si009392m.445.774
Selaginella moellendorffii102402
Sorghum bicolorSb01g034960.1Sb06g030930.1
Thellungiella halophilaThhalv10012727m
Vitis viniferaGSVIVT01032165001GSVIVT01007826001.97.439GSVIVT01007826001.97.439GSVIVT01007826001.468.836GSVIVT01007826001.468.836
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)