y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.009G225100.1
FamilyGH35
Protein PropertiesLength: 707 Molecular Weight: 78446.8 Isoelectric Point: 5.4964
ChromosomeChromosome/Scaffold: 09 Start: 33340672 End: 33345682
Descriptionbeta-galactosidase 7
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH351462263.1e-32
  VFMNWGSKDPHRTAEDVAYSVARFFQSGGTFQNYYMYHGGTNFGRTAGGPYITTTYDYDAPLDEFGNIAQPKWGHLKELHR
GH35361500
  IDGKRRVLISGSIHYPRSTPGMWPDLIKKAKEGGLDAIETYVFWNAHEGVRGEYDFNGRNDLIRFLKTIQDEGLYAVLRIGPYVCAEWDYGGIPVWVYNL
  PGVQIRTANQVFMNW
Full Sequence
Protein Sequence     Length: 707     Download
MAMSPQKAFV LTCFVSFLLH SINGVEVSHD GRAIKIDGKR RVLISGSIHY PRSTPGMWPD    60
LIKKAKEGGL DAIETYVFWN AHEGVRGEYD FNGRNDLIRF LKTIQDEGLY AVLRIGPYVC    120
AEWDYGGIPV WVYNLPGVQI RTANQVFMNW GSKDPHRTAE DVAYSVARFF QSGGTFQNYY    180
MYHGGTNFGR TAGGPYITTT YDYDAPLDEF GNIAQPKWGH LKELHRVLKS MENSLTNYGN    240
VSEVDLGHSV KATVYATNDS SSCFLTNTNT TTDATVTFRG NKYNIPAWSV SLLPDCQTEE    300
YNTAKVNVQT SLMVKGRNKA EDEPTALNWV WRAENIDDAL LGKGNFSEKR LIDQKTVASD    360
TSDYLWYMTR LDIDQNDPIL SDNMSLSING SGQVIHAFVN GEHIGSHWAT YGIRNDIFEP    420
EIKLKPGKNI VSLLSVTVGL QNYGPNYDKW PTGLVGPISV ISRKDDETVV KDLSSNKWSY    480
KVGLHGWDNK FFSEDSSYAS DSKWESEYLT TNRMLTWYKT TFKAPLGSEG VVVDLQGMGK    540
GYAWVNGHNL GRTWPSYEAS EDGCSDDPCD YRGEYDDKKY HVPRSFIQDG LNTMVLFEEI    600
GGNPSLVNFQ TVSVGSACGN THENKTLELS CHGHPISDIK FASFGNPQGE CGAFSKGSCE    660
SKSDALTIVQ NACVGKESCI IDVSEKTFGP ANCGDMVKRL AVEAVC*                  720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02140Gal_Lectin1.0e-1862970681+
pfam01301Glyco_hydro_353.0e-32116226114+
PLN03059PLN030595.0e-5027147121+
pfam01301Glyco_hydro_359.0e-6136149114+
PLN03059PLN030591.0e-142147706601+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004565beta-galactosidase activity
GO:0005529Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates." [CHEBI:16646, GOC:mah]
GO:0005975carbohydrate metabolic process
GO:0009341beta-galactosidase complex
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAJ09953.102714925148beta-galactosidase [Mangifera indica]
EMBLCAJ09953.10147706257827beta-galactosidase [Mangifera indica]
EMBLCBI27773.10147706271835unnamed protein product [Vitis vinifera]
RefSeqXP_002276918.13e-4057149193PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002276918.10147706202766PREDICTED: hypothetical protein [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4e8d_B7e-233614912124A Chain A, Crystal Structure Of The Fusion Glycoprotein E1 From Semliki Forest Virus
PDB4e8d_B0.002147212244314A Chain A, Crystal Structure Of The Fusion Glycoprotein E1 From Semliki Forest Virus
PDB4e8d_A7e-233614912124A Chain A, Crystal Structure Of The Fusion Glycoprotein E1 From Semliki Forest Virus
PDB4e8d_A0.002147212244314A Chain A, Crystal Structure Of The Fusion Glycoprotein E1 From Semliki Forest Virus
Signal Peptide
Cleavage Site
24
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DW1193973034177060
AJ7951072633205790
DK4612622351473790
HO7781604941476250
HO77816014441471.4013e-45
Orthologous Group
SpeciesID
Brassica rapaBra008306
Carica papayaevm.TU.contig_28540.1evm.model.supercontig_28.7
Cucumis sativusCucsa.155220.1Cucsa.374340.1
Linum usitatissimumLus10025108.29.144Lus10005070.37.184Lus10005070.37.184Lus10025110.33.156Lus10025110.33.156
Lus10025108.29.144Lus10025108.29.144Lus10020877.21.135Lus10020877.21.135
Malus domesticaMDP0000206653MDP0000275455
Phaseolus vulgarisPhvul.009G225100.1.36.150Phvul.009G225100.1.36.150
Picea abiesMA_10430283g0010MA_19375g0010MA_329922g0010
Ricinus communis59437.m0000529739.m003719.32.14629739.m003719.32.146
Vitis viniferaGSVIVT01006709001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny