y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.010G023800.1
FamilyCBM43
Protein PropertiesLength: 462 Molecular Weight: 50707.9 Isoelectric Point: 8.1286
ChromosomeChromosome/Scaffold: 10 Start: 3500201 End: 3505911
DescriptionO-Glycosyl hydrolases family 17 protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM433724553.4e-28
  WCVVAEGANVTEVAAALSYSCSQGNGTCDPIQPGHPCFKPDSVTSHADYAFSAYWAQFRRVGGTCYFNGLATQTAKDPSYGSCK
GH17273480
  VGVNYGQLGSNLPPARTSVRLIQSLKAKRVKIYDANAEILEALRNTGIEVSIMLPNELVVNASTNQTFSDQWVGSNVVPFYPQTLIRYLLVGNELISSTG
  NETWAHIVPAMHRISHSLKVFGLHKVKIGTPHAMDVLQSSFPPSNGTFRNDIAFHIMKPMLHFLHKTRSFFFLDVYPFFAWASDPAQINLSYTLFESRNI
  TVTDPLTGSIYTNLFDQMVDAVYFAMKRLGYPGIRIFIAETGWPNGGDLDQVGANVHNAATYNRNIVKRLTRNPVLGTPARPGSVLPAFIFSLYNENLKP
  GLGSERHFGLLYPNGSRVYDID
Full Sequence
Protein Sequence     Length: 462     Download
MAMAVISLFI LFFISFSISR GEISGEVGVN YGQLGSNLPP ARTSVRLIQS LKAKRVKIYD    60
ANAEILEALR NTGIEVSIML PNELVVNAST NQTFSDQWVG SNVVPFYPQT LIRYLLVGNE    120
LISSTGNETW AHIVPAMHRI SHSLKVFGLH KVKIGTPHAM DVLQSSFPPS NGTFRNDIAF    180
HIMKPMLHFL HKTRSFFFLD VYPFFAWASD PAQINLSYTL FESRNITVTD PLTGSIYTNL    240
FDQMVDAVYF AMKRLGYPGI RIFIAETGWP NGGDLDQVGA NVHNAATYNR NIVKRLTRNP    300
VLGTPARPGS VLPAFIFSLY NENLKPGLGS ERHFGLLYPN GSRVYDIDLS GNTPESELAP    360
VPPAMDYKGK AWCVVAEGAN VTEVAAALSY SCSQGNGTCD PIQPGHPCFK PDSVTSHADY    420
AFSAYWAQFR RVGGTCYFNG LATQTAKDPS YGSCKFPSVT L*                       480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07983X88.0e-1737244381+
smart00768X82.0e-3537245685+
pfam00332Glyco_hydro_172.0e-10627348323+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAM65039.101646114460putative glucan endo-1-3-beta-glucosidase [Arabidopsis thaliana]
EMBLCBI39470.101146113467unnamed protein product [Vitis vinifera]
RefSeqNP_683538.101646114460glycosyl hydrolase family 17 protein [Arabidopsis thaliana]
RefSeqXP_002303070.101646112461predicted protein [Populus trichocarpa]
RefSeqXP_002334812.1014612465predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2cyg_A0273491312A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_D0263501316A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_C0263501316A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_B0263501316A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_A0263501316A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
Signal Peptide
Cleavage Site
21
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX2913573561024520
EX2795003031024000
DT5722513011124090
EX279500174174332.2
EX279500134024142.2
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_034_00089.1.396.481Aquca_009_00879.1.376.461
Arabidopsis lyrata317589.371.454479892.387.470493503.389.472
Arabidopsis thalianaAT3G07320.1.371.454AT3G23770.1.387.470AT4G14080.1.389.472
Brachypodium distachyonBradi3g40907.1.397.480Bradi3g40907.1.397.480Bradi4g34390.1.385.471Bradi5g12137.1.382.465Bradi3g40907.1.501.584
Bradi3g40907.1.501.584
Brassica rapaBra001918.391.473Bra028343.387.470Bra037057.390.473Bra014979.389.472Bra001245.371.450
Bra032758.391.474Bra029639.371.454Bra038969.390.468
Carica papayaevm.model.supercontig_8.110.373.456evm.model.supercontig_157.32.380.459
Capsella rubellaCarubv10006945m.389.472Carubv10015952m.387.470Carubv10013655m.371.454
Citrus clementinaCiclev10031440m.377.460Ciclev10004917m.379.458
Citrus sinensisorange1.1g012660m.379.457
Cucumis sativusCucsa.251950.1.378.460Cucsa.149990.1.374.457
Eucalyptus grandisEucgr.K02113.2.377.460Eucgr.K02113.1.377.460Eucgr.H02646.1.352.434
Fragaria vescamrna17437.1-v1.0-hybrid.483.561mrna17436.1-v1.0-hybrid.347.425
Glycine maxGlyma18g32840.1.378.461Glyma08g46110.1.378.461
Gossypium raimondiiGorai.005G026800.1.373.456Gorai.001G230200.2.372.451Gorai.006G224700.1.373.456Gorai.001G230200.3.297.380Gorai.001G230200.1.372.455
Gorai.N004800.1.375.458
Linum usitatissimumLus10008881.379.462Lus10023226.358.441Lus10001740Lus10025892.333.417Lus10038211.374.458
Malus domesticaMDP0000317729.374.452MDP0000283768.334.416MDP0000235663.374.452
Manihot esculentacassava4.1_023781m.375.458cassava4.1_024973m.361.439cassava4.1_007070m.376.459
Medicago truncatulaMedtr8g012400.1.374.457
Mimulus guttatusmgv1a005774m.382.465mgv1a006049m.370.453
Oryza sativaLOC_Os09g32550.2.384.471LOC_Os09g32550.1.387.474LOC_Os03g62860.1.382.467LOC_Os08g41410.1.385.467
Panicum virgatumPavirv00066351m.389.471Pavirv00044843m.360.447Pavirv00008164m.395.481Pavirv00006057m.374.460Pavirv00059046m.386.467
Phaseolus vulgarisPhvul.010G023800.1.372.455Phvul.008G142200.1.376.459
Picea abiesMA_907g0010MA_2025g0010.240.322MA_10426132g0010.130.212MA_10434158g0010.296.378MA_228746g0010.274.356
Populus trichocarpaPotri.002G247900.2.376.454Potri.002G247900.1.376.459Potri.002G247800.1.376.459Potri.017G060300.1.377.460Potri.001G321900.1.327.410
Prunus persicappa006984m.298.381ppa016789m.361.446
Ricinus communis28401.m000073.298.381
Setaria italicaSi029669m.389.476Si015679m.397.484
Selaginella moellendorffii85067.362.443
Sorghum bicolorSb01g001430.1.390.476Sb02g029080.1.388.475Sb07g026540.1.393.478
Thellungiella halophilaThhalv10002513m.385.468Thhalv10025081m.390.473Thhalv10020660m.380.463Thhalv10020663m.380.463
Vitis viniferaGSVIVT01031619001.286.369GSVIVT01031698001.378.461
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)