y
Basic Information | |
---|---|
Species | Populus trichocarpa |
Cazyme ID | Potri.006G196400.1 |
Family | PL1 |
Protein Properties | Length: 119 Molecular Weight: 13811.6 Isoelectric Point: 7.29 |
Chromosome | Chromosome/Scaffold: 06 Start: 21210581 End: 21211233 |
Description | Pectin lyase-like superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
PL1 | 2 | 79 | 3.8e-29 |
THHDKVMLLGHSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRFVA |
Full Sequence |
---|
Protein Sequence Length: 119 Download |
MTHHDKVMLL GHSDSYTQDK NMQVTIAFNH FGEGLVQRMP RCRHGYFHVV NNDYTHWEMY 60 AIGGSANPTI NSQGNRFVAP DIRFSKEVTK HEDAPDQYKF LSSYIYIYPY INYGILFI* 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
COG3866 | PelB | 3.0e-11 | 4 | 77 | 77 | + Pectate lyase [Carbohydrate transport and metabolism] | ||
pfam00544 | Pec_lyase_C | 8.0e-38 | 2 | 77 | 76 | + Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue. | ||
smart00656 | Amb_all | 7.0e-40 | 1 | 81 | 81 | + Amb_all domain. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABK92535.1 | 0 | 1 | 97 | 115 | 211 | unknown [Populus trichocarpa] |
GenBank | ABO28478.1 | 0 | 1 | 97 | 66 | 162 | pectate lyase precursor [Glycine max] |
DDBJ | BAE48664.1 | 0 | 1 | 97 | 254 | 350 | Pectate lyase [Prunus mume] |
RefSeq | XP_002318694.1 | 0 | 1 | 97 | 244 | 340 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002322215.1 | 0 | 1 | 97 | 244 | 340 | predicted protein [Populus trichocarpa] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1pxz_B | 2e-31 | 3 | 90 | 194 | 281 | A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen |
PDB | 1pxz_A | 2e-31 | 3 | 90 | 194 | 281 | A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen |
PDB | 1pe9_B | 0.00000007 | 1 | 86 | 203 | 296 | A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen |
PDB | 1pe9_A | 0.00000007 | 1 | 86 | 203 | 296 | A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen |
PDB | 1ooc_B | 0.00000007 | 1 | 86 | 203 | 296 | A Chain A, Mutations In The T1.5 Loop Of Pectate Lyase A |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
BU893928 | 97 | 1 | 97 | 0 |
CF120027 | 97 | 1 | 97 | 0 |
CF119020 | 97 | 1 | 97 | 0 |
CA932691 | 97 | 1 | 97 | 0 |
CK100086 | 96 | 1 | 96 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|