| Basic Information | |
|---|---|
| Species | Populus trichocarpa |
| Cazyme ID | Potri.007G030200.1 |
| Family | GT1 |
| Protein Properties | Length: 105 Molecular Weight: 11344.1 Isoelectric Point: 7.6216 |
| Chromosome | Chromosome/Scaffold: 07 Start: 2267026 End: 2267340 |
| Description | UDP-Glycosyltransferase superfamily protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GT1 | 8 | 101 | 2.6e-23 |
| RARQTEILNHPSGGGFLPHCGWNSAVDSIANGVPMIAWPLNAEQGMNAALLAEDIGGAIRSKLLPWKEVMGREEIETMIRNIIEDKGDARRGRV | |||
| Full Sequence |
|---|
| Protein Sequence Length: 105 Download |
| MGVVVSMRAR QTEILNHPSG GGFLPHCGWN SAVDSIANGV PMIAWPLNAE QGMNAALLAE 60 DIGGAIRSKL LPWKEVMGRE EIETMIRNII EDKGDARRGR VRAH* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02167 | PLN02167 | 1.0e-18 | 9 | 102 | 97 | + UDP-glycosyltransferase family protein | ||
| PLN02207 | PLN02207 | 3.0e-20 | 11 | 101 | 94 | + UDP-glycosyltransferase | ||
| PLN02554 | PLN02554 | 5.0e-21 | 9 | 102 | 101 | + UDP-glycosyltransferase family protein | ||
| PLN02992 | PLN02992 | 1.0e-30 | 2 | 102 | 102 | + coniferyl-alcohol glucosyltransferase | ||
| PLN03015 | PLN03015 | 1.0e-31 | 1 | 103 | 104 | + UDP-glucosyl transferase | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0008152 | metabolic process |
| GO:0016758 | transferase activity, transferring hexosyl groups |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CAN77173.1 | 4e-32 | 1 | 102 | 340 | 442 | hypothetical protein [Vitis vinifera] |
| EMBL | CBI17565.1 | 2e-33 | 1 | 102 | 319 | 421 | unnamed protein product [Vitis vinifera] |
| RefSeq | XP_002273356.1 | 6e-33 | 1 | 102 | 340 | 442 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002310204.1 | 3.9937e-43 | 1 | 102 | 339 | 439 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002525101.1 | 5e-35 | 1 | 103 | 140 | 242 | UDP-glucosyltransferase, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2vg8_A | 4e-24 | 2 | 102 | 340 | 440 | A Chain A, Pectin Methylesterase From Yersinia Enterocolitica |
| PDB | 2vch_A | 4e-24 | 2 | 102 | 340 | 440 | A Chain A, Pectin Methylesterase From Yersinia Enterocolitica |
| PDB | 2vce_A | 4e-24 | 2 | 102 | 340 | 440 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
| PDB | 2pq6_A | 0.000000000000005 | 11 | 94 | 363 | 442 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
| PDB | 2acw_B | 0.000000000000005 | 9 | 91 | 340 | 424 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| anthocyanin biosynthesis (delphinidin 3-O-glucoside) | RXN-7815 | EC-2.4.1.115 | anthocyanidin 3-O-glucosyltransferase |
| anthocyanin biosynthesis (pelargonidin 3-O-glucoside, cyanidin 3-O-glucoside) | PELUDP-RXN | EC-2.4.1.115 | anthocyanidin 3-O-glucosyltransferase |
| anthocyanin biosynthesis (pelargonidin 3-O-glucoside, cyanidin 3-O-glucoside) | RXN1F-775 | EC-2.4.1.115 | anthocyanidin 3-O-glucosyltransferase |
| superpathway of anthocyanin biosynthesis (from cyanidin and cyanidin 3-O-glucoside) | RXN1F-775 | EC-2.4.1.115 | anthocyanidin 3-O-glucosyltransferase |
| Hydropathy |
|---|
 |
