Basic Information | |
---|---|
Species | Physcomitrella patens |
Cazyme ID | Pp1s11432_1V6.1 |
Family | GH4 |
Protein Properties | Length: 146 Molecular Weight: 15714.9 Isoelectric Point: 4.8843 |
Chromosome | Chromosome/Scaffold: 11432 Start: 29 End: 466 |
Description | |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH4 | 24 | 146 | 9e-34 |
KIAYIGGGSRGWAWGLMSDLALEPALSGHVALYDIDLAAAQANEVIGNRLQNHPDAVGRWRYEAVPTLPEALKGADFVIISILPGTFEEMRSDVHTPEAY GVYQSVGDTVGPGGAIRAMRSIP |
Full Sequence |
---|
Protein Sequence Length: 146 Download |
MFIVPSFKGS ERDMQEATTV KNLKIAYIGG GSRGWAWGLM SDLALEPALS GHVALYDIDL 60 AAAQANEVIG NRLQNHPDAV GRWRYEAVPT LPEALKGADF VIISILPGTF EEMRSDVHTP 120 EAYGVYQSVG DTVGPGGAIR AMRSIP |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd05197 | GH4_glycoside_hydrolases | 4.0e-11 | 23 | 146 | 126 | + Glycoside Hydrases Family 4. Glycoside hydrolases cleave glycosidic bonds to release smaller sugars from oligo- or polysaccharides. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by GH4 glycoside hydrolases. Other organisms (such as archaea and Thermotoga maritima) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. GH4 family members include 6-phospho-beta-glucosidases, 6-phospho-alpha-glucosidases, alpha-glucosidases/alpha-glucuronidases (only from Thermotoga), and alpha-galactosidases. They require two cofactors, NAD+ and a divalent metal (Mn2+, Ni2+, Mg2+), for activity. Some also require reducing conditions. GH4 glycoside hydrolases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others. | ||
PRK15076 | PRK15076 | 1.0e-23 | 24 | 146 | 125 | + alpha-galactosidase; Provisional | ||
COG1486 | CelF | 3.0e-29 | 21 | 146 | 128 | + Alpha-galactosidases/6-phospho-beta-glucosidases, family 4 of glycosyl hydrolases [Carbohydrate transport and metabolism] | ||
pfam02056 | Glyco_hydro_4 | 2.0e-34 | 24 | 146 | 127 | + Family 4 glycosyl hydrolase. | ||
cd05297 | GH4_alpha_glucosidase_galactosidase | 2.0e-50 | 23 | 146 | 125 | + Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
GO:0005975 | carbohydrate metabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
RefSeq | XP_001787116.1 | 0 | 1 | 146 | 1 | 146 | predicted protein [Physcomitrella patens subsp. patens] |
RefSeq | YP_001181504.1 | 0 | 21 | 146 | 9 | 134 | glycoside hydrolase family protein [Caldicellulosiruptor saccharolyticus DSM 8903] |
RefSeq | YP_002573878.1 | 0 | 21 | 146 | 9 | 134 | glycoside hydrolase family 4 [Anaerocellum thermophilum DSM 6725] |
RefSeq | ZP_04851243.1 | 0 | 13 | 146 | 3 | 136 | glycoside hydrolase [Paenibacillus sp. oral taxon 786 str. D14] |
RefSeq | ZP_05335652.1 | 0 | 20 | 146 | 8 | 134 | glycoside hydrolase family 4 [Thermoanaerobacterium thermosaccharolyticum DSM 571] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3fef_D | 0 | 19 | 146 | 2 | 124 | A Chain A, Crystal Structure Of Putative Glucosidase Lpld From Bacillus Subtilis |
PDB | 3fef_C | 0 | 19 | 146 | 2 | 124 | A Chain A, Crystal Structure Of Putative Glucosidase Lpld From Bacillus Subtilis |
PDB | 3fef_B | 0 | 19 | 146 | 2 | 124 | A Chain A, Crystal Structure Of Putative Glucosidase Lpld From Bacillus Subtilis |
PDB | 3fef_A | 0 | 19 | 146 | 2 | 124 | A Chain A, Crystal Structure Of Putative Glucosidase Lpld From Bacillus Subtilis |
PDB | 1obb_B | 0.00009 | 22 | 129 | 3 | 109 | A Chain A, Alpha-Glucosidase A, Agla, From Thermotoga Maritima In Complex With Maltose And Nad+ |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DY233383 | 117 | 15 | 123 | 7.2 |
DY036998 | 75 | 36 | 103 | 8 |