y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhyscomitrella patens
Cazyme IDPp1s353_23V6.2
FamilyGH16
Protein PropertiesLength: 239 Molecular Weight: 26743.9 Isoelectric Point: 4.8483
ChromosomeChromosome/Scaffold: 353 Start: 134687 End: 137484
Descriptionxyloglucan endotransglucosylase/hydrolase 1
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH16472088.3e-26
  IEVDYGHEVLDHSKDAREIAISYDARNGARWRTTHRFESGIFSAKIKVPAGNTSGLNCSFYLSSLEGDKFQDEIDFEFLGKDKTIIQTNVYTEGVGNREE
  IHQLGFDSSETFHEYAIHWTPTEILWFIDQVQVRKHERKPNDAYPMKPMFLYASVWNAGWVN
Full Sequence
Protein Sequence     Length: 239     Download
MNGGDCGGSC ACVGTAAPSM QVPDSSMQCM ATPKPVLLTT TKHLNDIEVD YGHEVLDHSK    60
DAREIAISYD ARNGARWRTT HRFESGIFSA KIKVPAGNTS GLNCSFYLSS LEGDKFQDEI    120
DFEFLGKDKT IIQTNVYTEG VGNREEIHQL GFDSSETFHE YAIHWTPTEI LWFIDQVQVR    180
KHERKPNDAY PMKPMFLYAS VWNAGWVNNG EWAGCYVGCD EPYVCTYKDV QVPHLPDQ*     240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd02183GH16_fungal_CRH1_transglycosylase3.0e-2586232158+
PLN03161PLN031614.0e-2970210148+
cd02175GH16_lichenase1.0e-3264216161+
pfam00722Glyco_hydro_165.0e-4759214163+
cd02176GH16_XET2.0e-5059232186+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_001048767.10252333218Os03g0117300 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001150346.10262335213xyloglucan endotransglucosylase/hydrolase protein 5 [Zea mays]
RefSeqXP_001783128.108523867220predicted protein [Physcomitrella patens subsp. patens]
RefSeqXP_002273975.10352334202PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002301319.10352334202predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vh9_B2e-356123259234A Chain A, Crystal Structure Of Nxg1-Deltayniig In Complex With Xllg, A Xyloglucan Derived Oligosaccharide
PDB2vh9_A2e-356123259234A Chain A, Crystal Structure Of Nxg1-Deltayniig In Complex With Xllg, A Xyloglucan Derived Oligosaccharide
PDB2uwb_B2e-356123236211A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig
PDB2uwb_A2e-356123236211A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig
PDB2uwc_B2e-336123235215A Chain A, Crystal Structure Of Nasturtium Xyloglucan Hydrolase Isoform Nxg2
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FC341329196432380
BQ040354190402290
FC436794155852390
BY95058814211420
FC4367946623882e-36
Orthologous Group
SpeciesID
Citrus clementinaCiclev10022200m
Citrus sinensisorange1.1g028023m
Eucalyptus grandisEucgr.D02237.1
Fragaria vescamrna18893.1-v1.0-hybrid
Glycine maxGlyma07g08550.2
Gossypium raimondiiGorai.007G095000.2Gorai.007G095000.1
Manihot esculentacassava4.1_016069m
Physcomitrella patensPp1s24_272V6.1Pp1s353_23V6.6Pp1s353_23V6.1Pp1s353_23V6.3Pp1s353_23V6.4
Pp1s353_23V6.5
Phaseolus vulgarisPhvul.010G092400.1
Picea abiesMA_52109g0010
Populus trichocarpaPotri.002G153200.1
Prunus persicappa027011m
Setaria italicaSi039715m
Selaginella moellendorffii75086
Sorghum bicolorSb01g049420.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny