y PlantCAZyme

CAZyme Information

Basic Information
SpeciesVolvox carteri
Cazyme IDVocar20002846m
FamilyGT47
Protein PropertiesLength: 738 Molecular Weight: 78851.4 Isoelectric Point: 6.8136
ChromosomeChromosome/Scaffold: 2 Start: 3480567 End: 3487453
DescriptionExostosin family protein
View CDS
External Links
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT473045987.2e-25
  LLPARFAQHSGPWWLRQALAASLNVVHDIQKADIVYVDDFCYAAWSEAKLHDRGAWGPSEEMYVDPDIYLAAAFHLLLKHRSFRGTGGAQFVFFHSHPAL
  FLYHAVLCNPAFAAALHLVPEALVRQNCGPSRMLVVPYASFPFYHNPTAADVVADAVVATAAGASRVPSSSDPVRPRLLHFRGTCGGNSDGKALRRAVVE
  ALHDVSAPADATATETANASILASCESFTWEDLSLVELSKSRYCLILAGDTASSRRLSEAVLMGCVPVFLGPPFAATPLSGVVRYDAFALVFEVP
Full Sequence
Protein Sequence     Length: 738     Download
MAKRATGGDV AVMAADMAAA AGSVNPDAAA AGGPGASPAG APMSPIEAKL AAVTQTFLND    60
MCSGLNREMA PHLPPEKVKE LASMHLAPDA VVHVDGLLHS VPPVTGPQAF FDFITLERAA    120
YRAMSLDTLL VAVSPTGDTV FALSRFKMKN VGPWHGKAAT RRISEGVRID ELRFDDTGGK    180
IIEAWCNRQL FQEERDLLLR EPDRHHPAVF DPALLAAVSP PEGGHGGLTA PDQLLRVAQI    240
WAETWNMASI AGPPDPDILD TLADHDFHLM DALGFTGDDA QSHPFTRSTI RNDDRASQHA    300
TRGLLPARFA QHSGPWWLRQ ALAASLNVVH DIQKADIVYV DDFCYAAWSE AKLHDRGAWG    360
PSEEMYVDPD IYLAAAFHLL LKHRSFRGTG GAQFVFFHSH PALFLYHAVL CNPAFAAALH    420
LVPEALVRQN CGPSRMLVVP YASFPFYHNP TAADVVADAV VATAAGASRV PSSSDPVRPR    480
LLHFRGTCGG NSDGKALRRA VVEALHDVSA PADATATETA NASILASCES FTWEDLSLVE    540
LSKSRYCLIL AGDTASSRRL SEAVLMGCVP VFLGPPFAAT PLSGVVRYDA FALVFEVPTA    600
SATWLRRHRR QLQQQHHHHH RQPLFVDAVS GHPFDDDGGG GGGGGGGGGG RGIGIQRFAT    660
RLTALQDLPA ALHAIGRRRY AAMSYNLAAV RPFFSFVADP DGGPLAGLND VLYSRMCFHA    720
AGGPEATARR AHLPGKV*                                                  780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03016Exostosin6.0e-8311597297+
Gene Ontology
GO TermDescription
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAC18793.10.000000731162396422End is cut off [Arabidopsis thaliana]
GenBankABK24530.10.0000003310627109410unknown [Picea sitchensis]
RefSeqNP_176908.20.000000531162396392exostosin family protein [Arabidopsis thaliana]
RefSeqXP_001696600.10.00000037619263204hypothetical protein CHLREDRAFT_167348 [Chlamydomonas reinhardtii]
RefSeqXP_002512333.10.00000003310623100394catalytic, putative [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO4749661274816010.00000000000002
HO4467411224815960.00000000000009
GW2417181483054410.0000000000001
GE2644592623385830.0000000000008
HO474966923114010.0006