CAZyme Information

Basic Information
SpeciesManihot esculenta
Cazyme IDcassava4.1_010616m
FamilyGT77
Protein PropertiesLength: 356 Molecular Weight: 40609.1 Isoelectric Point: 10.0938
ChromosomeChromosome/Scaffold: 02658 Start: 556137 End: 558561
DescriptionNucleotide-diphospho-sugar transferase family protein
View CDS
External Links
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT771183350
  QDKVLVIAEDYATLYKINERWPGHAVLVPPAPDSQTAHKFGSQGFFNFTSRRPRHLLQILELGYNVMYNDVDMVWLGDPFPYLQRKHDVYFTDDMAAVKP
  LNHSHDLPPPGKKGRTYICSCMIFLRPTGGAKLVMKKWIEELKAQPWSKAKKSNDQPAFNWALNKTAGQVDLYLLPQAAFPTGGLYFKNQTWVQETKGKH
  VIIHNNYITGFEKKIKRF
Full Sequence
Protein Sequence     Length: 356     Download
MPSFLHQRPL YSALSAPYPI SPRYSFNSQR QISIFSRTGL IVLFSLMLIL GVFMPWTGMP    60
QGIFSVSKPS LTKWRQYTLA QAASFVAKNG TVIVCAVSQP YLPFLNNWLI SIARQNHQDK    120
VLVIAEDYAT LYKINERWPG HAVLVPPAPD SQTAHKFGSQ GFFNFTSRRP RHLLQILELG    180
YNVMYNDVDM VWLGDPFPYL QRKHDVYFTD DMAAVKPLNH SHDLPPPGKK GRTYICSCMI    240
FLRPTGGAKL VMKKWIEELK AQPWSKAKKS NDQPAFNWAL NKTAGQVDLY LLPQAAFPTG    300
GLYFKNQTWV QETKGKHVII HNNYITGFEK KIKRFHDFGL WLADDHYQES PLGKL*        360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03407Nucleotid_trans2.0e-45116335225+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN69309.10473551309hypothetical protein [Vitis vinifera]
EMBLCBI31422.10143559901331unnamed protein product [Vitis vinifera]
RefSeqXP_002273155.101535520360PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002279469.101435520361PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002511939.1013551356conserved hypothetical protein [Ricinus communis]
Transmembrane Domains
StartEnd
3456
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY29448334713430
DY264723279553330
FC914138270553240
DY26803635913550
FC87960128712840
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_074_00044.1
Arabidopsis lyrata352664892838490401474813912111
Arabidopsis thalianaAT4G01220.1AT1G56550.1AT4G01750.1AT4G01220.2AT4G01770.1
Brachypodium distachyonBradi2g26850.1
Brassica rapaBra035432Bra036306Bra000906Bra039864Bra017900
Bra037377Bra000950Bra035431Bra000907
Carica papayaevm.model.supercontig_184.13
Capsella rubellaCarubv10001259mCarubv10001249mCarubv10021691m
Citrus clementinaCiclev10020808mCiclev10022071mCiclev10021218m
Citrus sinensisorange1.1g018302morange1.1g027009morange1.1g021054m
Cucumis sativusCucsa.135840.2Cucsa.135840.1
Eucalyptus grandisEucgr.E00084.1
Fragaria vescamrna09360.1-v1.0-hybrid
Glycine maxGlyma08g09360.1
Gossypium raimondiiGorai.004G154200.4Gorai.007G104400.1Gorai.004G154200.1Gorai.004G154200.5Gorai.004G154200.3
Gorai.004G154200.2
Linum usitatissimumLus10002153Lus10012650Lus10008735
Malus domesticaMDP0000150593MDP0000264889
Manihot esculentacassava4.1_010633m
Mimulus guttatusmgv1a008876m
Oryza sativaLOC_Os05g32120.1
Panicum virgatumPavirv00063401mPavirv00048789m
Physcomitrella patensPp1s19_296V6.1
Phaseolus vulgarisPhvul.002G188500.1
Picea abiesMA_10233136g0010MA_173768g0010
Populus trichocarpaPotri.014G092400.2Potri.002G166000.1Potri.014G092400.1
Prunus persicappa007793m
Ricinus communis30174.m008682
Setaria italicaSi022588mSi017632m
Selaginella moellendorffii87970
Sorghum bicolorSb09g019070.1
Thellungiella halophilaThhalv10029467mThhalv10015591mThhalv10024021mThhalv10024115mThhalv10028748m
Vitis viniferaGSVIVT01016220001GSVIVT01027019001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny