| Basic Information | |
|---|---|
| Species | Carica papaya |
| Cazyme ID | evm.TU.contig_31192.1 |
| Family | GH17 |
| Protein Properties | Length: 133 Molecular Weight: 13914 Isoelectric Point: 4.6745 |
| Chromosome | Chromosome/Scaffold: 31192 Start: 95 End: 493 |
| Description | O-Glycosyl hydrolases family 17 protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH17 | 9 | 131 | 9.5e-40 |
| VGINIGTDVSDMPPASDVVTLIRANQITHVRLYDADSHMLKALSGSEIEVMVGVTNEEVLGIGESPSVAAAWINKNVAAYLPSTNITAIAVGSELITTIP HAAPVLVTAMNSLHKALVAANLN | |||
| Full Sequence |
|---|
| Protein Sequence Length: 133 Download |
| MCYLVGAFVG INIGTDVSDM PPASDVVTLI RANQITHVRL YDADSHMLKA LSGSEIEVMV 60 GVTNEEVLGI GESPSVAAAW INKNVAAYLP STNITAIAVG SELITTIPHA APVLVTAMNS 120 LHKALVAANL NFQ |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam00332 | Glyco_hydro_17 | 2.0e-26 | 9 | 130 | 122 | + Glycosyl hydrolases family 17. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| DDBJ | BAH57260.1 | 0 | 7 | 133 | 24 | 150 | AT3G13560 [Arabidopsis thaliana] |
| EMBL | CAN72077.1 | 0 | 10 | 133 | 27 | 150 | hypothetical protein [Vitis vinifera] |
| RefSeq | NP_187965.1 | 0 | 7 | 133 | 24 | 150 | glycosyl hydrolase family 17 protein [Arabidopsis thaliana] |
| RefSeq | XP_002283548.1 | 0 | 10 | 133 | 27 | 150 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002532062.1 | 0 | 6 | 133 | 23 | 150 | Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2cyg_A | 1e-21 | 9 | 133 | 1 | 124 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_D | 1e-18 | 9 | 133 | 2 | 128 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_C | 1e-18 | 9 | 133 | 2 | 128 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_B | 1e-18 | 9 | 133 | 2 | 128 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_A | 1e-18 | 9 | 133 | 2 | 128 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| DW488425 | 130 | 4 | 133 | 0 |
| DW488424 | 130 | 4 | 133 | 0 |
| DW480479 | 130 | 4 | 133 | 0 |
| DW480480 | 130 | 4 | 133 | 0 |
| AI727721 | 130 | 4 | 133 | 0 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Citrus clementina | Ciclev10014440m.31.104 | ||||
| Ricinus communis | 30084.m000179.26.152 | 30084.m000179.26.152 | |||
| Vitis vinifera | GSVIVT01025431001.26.144 | ||||
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |