CAZyme Information

Basic Information
SpeciesPrunus persica
Cazyme IDppa022156m
FamilyGH1
Protein PropertiesLength: 272 Molecular Weight: 30693.3 Isoelectric Point: 8.6383
ChromosomeChromosome/Scaffold: 6 Start: 3765691 End: 3768334
Descriptionbeta glucosidase 12
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1452700
  GVDGCFDEKEGPYLVLHHLLLAYANSVKLYKTKYQTSQKGLMGITIVKHWFVPLSESKQNKAPALRVLDLCMDAATRIASGEYPRRMLAILGRQLSKFTR
  AQSKLLAGSLDFLGINYYASYYASDAHKSTQLSLNGVQGALDWLNIYPKGIEELLIYTTNKYRNSLIYITENGIDEFNNPKLSLAEVLNDTTKIDYYKHH
  IYYIQSAIRRGDRVKGYFPWSLLDNY
Full Sequence
Protein Sequence     Length: 272     Download
MAVEMGCYSV GREGLLEDLA LFWKHGVEVT VLSSSPGHID AILQGVDGCF DEKEGPYLVL    60
HHLLLAYANS VKLYKTKYQT SQKGLMGITI VKHWFVPLSE SKQNKAPALR VLDLCMDAAT    120
RIASGEYPRR MLAILGRQLS KFTRAQSKLL AGSLDFLGIN YYASYYASDA HKSTQLSLNG    180
VQGALDWLNI YPKGIEELLI YTTNKYRNSL IYITENGIDE FNNPKLSLAE VLNDTTKIDY    240
YKHHIYYIQS AIRRGDRVKG YFPWSLLDNY K*                                  300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02849PLN028491.0e-1672271211+
PLN02998PLN029989.0e-1773271213+
PLN02814PLN028142.0e-1972271216+
TIGR03356BGL2.0e-2487270192+
pfam00232Glyco_hydro_11.0e-3170270224+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAF34650.1056271241475AF221526_1 prunasin hydrolase isoform PHA precursor [Prunus serotina]
GenBankAAL07435.1056271215449AF413214_1 prunasin hydrolase isoform PH A precursor [Prunus serotina]
GenBankABI34907.3035271101356glycoside hydrolase family 1 protein [Leucaena leucocephala]
GenBankABY48758.1035271214469glycosylhydrolase 1 [Leucaena leucocephala]
GenBankABY84677.1035271117372coniferrin beta glucosidase [Leucaena leucocephala]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ptq_B035271213468A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase
PDB3ptq_A035271213468A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase
PDB3ptm_B035271213468A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase
PDB3ptm_A035271213468A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase
PDB3ptk_B035271213468A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CA784088220712710
CV186947222692710
FF380557219752710
JG131901226702710
CV544007223702690