CAZyme Information: MGYG000000020_00694

Basic Information

• Species: Latilactobacillus curvatus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Latilactobacillus; Latilactobacillus curvatus
• CAZyme ID: MGYG000000020_00694
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
566	MGYG000000020_8|CGC2	65616.16	8.0211

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000020	1923680	Isolate	United Kingdom	Europe

• Gene Location: Start: 50183; End: 51883 Strand: +

Full Sequence      

MVIINAINIMFAADENYGDQLLIAIKSVLTHISPKTTINFFILDNELTPQTKHAVSKRVP
RPNQVEFIALNKQLFENCPESNHINKTAYYRILAPTLLLREKIERVLYLDVDILVQTDLT
PLYNTPLGTNIVGAVIDPGQALTLRRLGITPPQSNNIYFNSGVMLIDTVRWNHASITERT
FHFINHHADRLQFHDQNALNATLVGKVKLLHPKWNVQNSLLFRKHAPINTEYAHLFDEAI
ANPAIVHFTTHEKPWNTLKSHPFLNQYQKELKQLHAQQSDIINIVSAVNSDFIETLAILY
ASILNHNDSHRHYAFYVLEDHLTARDKAVLQHVVARFDADLTFAEVNESLLANTVESDRI
LKTAYYRILIPDVFPHLDRALYIDCDALCLTDLARLWDIDLGQSFLAAVEDAGFHERLEK
MAIDYQSPRYFNSGVMLLNLKKWRQHNIVSRVLDFINQHPEKLRFHDQDALNAILHDRWI
HLHPMWNAQTNILMNTITPPTEHLKKQFLETQKEPALVHFCGHEKPWHASSSHPFTPQYR
YYRQRFLKQKKRLVPFANRRSLSQQG

Enzyme Prediction     

No EC number prediction in MGYG000000020_00694.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	266	529	4.3e-61	0.9377431906614786
GT8	5	258	9.5e-55	0.8871595330739299

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04194	GT8_A4GalT_like	3.18e-84	282	528	1	247	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
cd04194	GT8_A4GalT_like	3.33e-77	7	257	1	248	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
COG1442	RfaJ	1.18e-57	281	539	2	256	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01501	Glyco_transf_8	4.20e-52	283	528	1	249	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
pfam01501	Glyco_transf_8	2.96e-42	8	256	1	249	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBE27027.1	0.0	1	566	1	566
BCX30544.1	0.0	1	566	1	566
AXN36658.1	0.0	10	566	1	557
ASN60906.1	0.0	10	566	1	557
QAR36427.1	0.0	10	566	1	557

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1SS9_A	5.22e-24	8	256	2	253	ChainA, alpha-1,4-galactosyl transferase [Neisseria meningitidis]
1G9R_A	5.96e-23	8	215	2	208	ChainA, GLYCOSYL TRANSFERASE [Neisseria meningitidis],1GA8_A Chain A, GALACTOSYL TRANSFERASE LGTC [Neisseria meningitidis]
6U4B_A	1.16e-18	282	527	302	568	ChainA, WbbM protein [Klebsiella pneumoniae]
3TZT_A	4.89e-17	288	542	12	267	Thestructure of a protein in glycosyl transferase family 8 from Anaerococcus prevotii. [Anaerococcus prevotii DSM 20548],3TZT_B The structure of a protein in glycosyl transferase family 8 from Anaerococcus prevotii. [Anaerococcus prevotii DSM 20548]
5GVV_A	1.54e-14	365	531	88	239	Crystalstructure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVV_F Crystal structure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25148	1.06e-74	277	542	2	270	General stress protein A OS=Bacillus subtilis (strain 168) OX=224308 GN=gspA PE=1 SV=2
P43974	4.75e-26	279	533	36	284	Putative glycosyltransferase HI_0258 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0258 PE=3 SV=2
A0A0H2URH7	8.24e-20	268	542	288	541	Glycosyltransferase GlyA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyA PE=3 SV=1
A0A0H2URH2	2.23e-19	283	531	4	233	Glycosyltransferase GlyF OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyF PE=3 SV=1
Q9AEU2	2.49e-19	284	527	19	238	Probable glycosyl transferase Gly OS=Streptococcus gordonii OX=1302 GN=gly PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999821	0.000131	0.000035	0.000002	0.000000	0.000024

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000020_00694.