CAZyme Information: MGYG000000057_00438

Basic Information

• Species: Bacteroides sp002491635
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp002491635
• CAZyme ID: MGYG000000057_00438
• CAZy Family: GT113
• CAZyme Description: Beta-1,6-galactofuranosyltransferase WbbI

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
346		39654.03	9.3174

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000057	4370351	Isolate	United Kingdom	Europe

• Gene Location: Start: 251516; End: 252556 Strand: -

Full Sequence      

MKCYLSRNYKGVSSSGYKAKTDMEDLMAGWGFRNIGLKRTFYPHVIVSFVLTLFGVLKAL
VCLRKGDILFLQYPLKKYFSFICNVAHFKGCKIVILIHDLGSFRRKKLSVSQEIKRLEHA
DYIIATNPAMQQWIKDRHCQMPVGHLGVWDYLSVARPDAHKELPSPPYQIVYAGALSRRK
NAFLYSWGEKIEGYSVNLYGSGFFLEEAKGREHFRIKGFVQSDTLIESVEGDFGLVWDGD
SVETCCGDFGEYLQFNTPHKTSLYIRCGLPVIIWERAALAPFVQSNRLGLCIGKLEDLNR
LLLSITVEEYREMRNNVLRMSDRISKGFYFKQAAEKAIAFLQTTNQ

Enzyme Prediction     

No EC number prediction in MGYG000000057_00438.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT113	13	338	1.4e-91	0.9720496894409938

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09814	PRK09814	7.01e-71	1	338	1	330	sugar transferase.
cd03794	GT4_WbuB-like	5.45e-07	47	336	82	389	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
cd03801	GT4_PimA-like	1.03e-04	57	227	74	263	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03809	GT4_MtfB-like	0.001	87	181	98	206	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQT78203.1	1.05e-126	1	341	1	339
QUU07104.1	1.05e-126	1	341	1	339
QRP56553.1	1.05e-126	1	341	1	339
ASM65269.1	1.05e-126	1	341	1	339
QIU93766.1	2.64e-114	1	341	1	338

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4W6Q_A	2.28e-18	1	338	3	326	GlycosyltransferaseC from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_B Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_C Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_D Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37749	4.40e-53	15	343	14	329	Beta-1,6-galactofuranosyltransferase WbbI OS=Escherichia coli (strain K12) OX=83333 GN=wbbI PE=1 SV=1
A0A0M3KKZ0	1.22e-17	1	338	1	324	Glucosyltransferase 3 OS=Streptococcus agalactiae serotype III (strain COH1) OX=342616 GN=gtf3 PE=1 SV=2
A0A0H2UR93	3.26e-17	1	341	1	333	Glucosyltransferase 3 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gtf3 PE=1 SV=1
Q9AEU1	3.17e-15	66	338	65	329	Glucosyltransferase 3 OS=Streptococcus gordonii OX=1302 GN=gtf3 PE=3 SV=1
B3XPQ7	2.86e-09	80	338	83	329	Glucosyltransferase 3 OS=Limosilactobacillus reuteri (strain DSM 17509 / CIP 109821 / 100-23) OX=349123 GN=gtf3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999987	0.000024	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
41	63