CAZyme Information: MGYG000000079_02189

Basic Information

• Species: Exiguobacterium sp902362975
• Lineage: Bacteria; Firmicutes; Bacilli; Exiguobacterales; Exiguobacteraceae; Exiguobacterium; Exiguobacterium sp902362975
• CAZyme ID: MGYG000000079_02189
• CAZy Family: CBM50
• CAZyme Description: putative peptidoglycan endopeptidase LytE

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
158	MGYG000000079_33|CGC1	16703.43	10.0481

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000079	2825544	Isolate	United Kingdom	Europe

• Gene Location: Start: 428; End: 904 Strand: +

Full Sequence      

MYTVKSGDTLYSIARTYGVTVSALAAANNITNYSLIYVGQVLIIPGTTVTPPTTPVKYTV
KSGDTLYKIATMYNTTVAKIAAANNIANVNSIYVGQVLVIPGTTVTPLTTTVKYTVKLGD
TLYKIATMYNTTVAKIAGANNITNVSLISVGQVLTIPR

Enzyme Prediction     

No EC number prediction in MGYG000000079_02189.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	2	45	9e-19	0.975
CBM50	58	101	9.9e-18	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK06347	PRK06347	5.26e-17	2	156	408	591	1,4-beta-N-acetylmuramoylhydrolase.
cd00118	LysM	7.52e-16	2	44	3	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
pfam01476	LysM	5.39e-15	2	45	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
PRK06347	PRK06347	4.31e-14	1	156	332	523	1,4-beta-N-acetylmuramoylhydrolase.
smart00257	LysM	5.91e-14	2	44	2	44	Lysin motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACQ70847.1	7.21e-87	2	158	240	396
QPI67555.1	1.94e-84	2	158	240	397
QUE86520.1	2.44e-80	2	158	240	399
ANU13868.1	5.97e-64	2	158	242	398
ANU19959.1	1.63e-60	2	158	239	397

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4B8V_A	1.48e-17	2	158	44	218	ChainA, Extracellular Protein 6 [Fulvia fulva],4B9H_A Chain A, Extracellular Protein 6 [Fulvia fulva]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q49UX4	7.65e-18	2	147	29	185	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=sle1 PE=3 SV=1
P37710	4.65e-15	2	158	431	610	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
P54421	2.52e-14	4	156	30	192	Probable peptidoglycan endopeptidase LytE OS=Bacillus subtilis (strain 168) OX=224308 GN=lytE PE=1 SV=1
A2RHZ5	1.21e-13	2	100	245	362	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
O31852	2.18e-13	4	147	31	192	D-gamma-glutamyl-meso-diaminopimelic acid endopeptidase CwlS OS=Bacillus subtilis (strain 168) OX=224308 GN=cwlS PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.992777	0.007130	0.000053	0.000015	0.000008	0.000017

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000079_02189.