CAZyme Information: MGYG000000343_00973

Basic Information

• Species: Odoribacter sp900548135
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter; Odoribacter sp900548135
• CAZyme ID: MGYG000000343_00973
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
772		85540.68	5.9495

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000343	3841231	MAG	Sweden	Europe

• Gene Location: Start: 159011; End: 161329 Strand: -

Full Sequence      

MKKIGWIMLIVAGILNGCTRNNKVDTSVYMNASQPTEKRVEALLSQMTLKEKIGQMDMVA
IWDKEKIIDQGVPDYGAWIGDAKPDVMNELQKLSEQTRLKIPYLIGVDAAHGYAVLPGKT
VFPSAISMAATFNRDLVKDMYAASASEIRSAGNQWTFAPCIDIVHDARWGRTGETYGEDP
YLAGEMVKNAISGLQDWEDPQKRVAACPKHLLGGGASVGGCNHAPAELSERMVRSYFLPP
FQAAIEAGCMTIMPGHNEVDGMPAHASKWLLTDIVKDELGFQGFYISDMGDVENLRNIHN
VATDQKDAVRQAFQAGLDMHMYYGGDSTRLMRPWLEELVKEGKITEECVNNAVRRILRVK
FELGLFENRYVDPTKEVCAPEAHRQLALEGARENIVLLKNKNNLLPLDLKKYKRILVTGP
NADNQTILGDWANPQPQDMVTTILEGIRQEAEGKAEVVYSNSGRIRGKASKDKIDTTDPL
TQAHLLEEGGEISDYSIADAVKKAHSCDLAIVAVGGYGLRSDWGLRTYGESADRPSIDFY
GRQEELIRAINQTGIPLVVVIVNGKPLNNEWTTRHIPAIVDAWEPGMYGGQAVAEVLFGK
INPSGKLPVTIPQQAGQVPMYYYQKETRYTTGYGLGSSRADEKPAYCFGHGLSYTRFEYS
DLKMDTLVTTGQDINISFRVKNTGEREGKEVPMLFIGDEVSSITTPIAMLKGFDKISLQP
GEEKTVTFTVPYKHLGLWNADMKYVVEPGLFSVKIGRSYQDIRLKGVFSVVS

Enzyme Prediction     

No EC number prediction in MGYG000000343_00973.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	94	321	8.3e-71	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	2.16e-178	34	763	32	758	beta-glucosidase BglX.
COG1472	BglX	9.01e-101	47	452	1	388	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	7.03e-80	29	756	42	769	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	3.05e-75	48	359	1	316	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	2.82e-58	395	654	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUU08173.1	0.0	1	770	1	767
QRP57287.1	0.0	1	770	1	767
ASM65975.1	0.0	1	770	1	767
QQT77469.1	0.0	1	770	1	767
QCQ49054.1	0.0	15	765	17	765

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z87_A	3.30e-140	29	763	36	778	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5Z9S_A	2.24e-136	25	765	13	781	Functionaland Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum],5Z9S_B Functional and Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum]
5XXL_A	8.33e-133	34	763	8	745	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	4.57e-132	34	763	8	745	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5TF0_A	1.77e-128	31	763	2	744	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	1.46e-141	1	767	1	718	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
Q56078	2.24e-134	40	756	38	751	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	3.16e-134	40	771	38	765	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH9	1.39e-124	1	763	1	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	3.02e-107	8	762	7	768	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000062	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000343_00973.