CAZyme Information: MGYG000000389_01976

Basic Information

• Species: Roseburia sp900550935
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Roseburia; Roseburia sp900550935
• CAZyme ID: MGYG000000389_01976
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1350	MGYG000000389_16|CGC1	145959.61	9.3264

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000389	2762523	MAG	Sweden	Europe

• Gene Location: Start: 33503; End: 37555 Strand: -

Full Sequence      

MMRKKLEWLKRGACLVLAGTLVLCSENVSYAAMTTSVQAETQDSSETSDQSETETENAGE
TGTDENTEQEKTTETTENTEATETTETTETTETTENTEVTETTETTETTEETEATEETET
KEEKIPNGVTLNTAVLYRVIAIGEQLTLPEYTISYTDPSATGSDAEVVWSDDGLGIISLD
AAGNKVTGVKAGVTTLTLQVKGTQYATEYHVIVTPAAPASVNQTATTYQTAELSWSAVEG
AKGYRVYRKGESDAEFQMVAEVEGNTSYKDSGLELGTKYIYRIKSYVTYKDASNTQQYAE
SDTYGQIGVTLSLGKTTIESASAVAYNSVQIRWRALEGAEGYTVYRAEGASNSFAELSTV
TGTDYTDNNVVAGTTYRYQVKGYRTVNGTRVYGDASDAVTVKPMPGTTNLSAVVKGVTSV
KLTWDKVEGASGYEVCRKVSGDDDFKKIKTVEGGNKTSYTDKKLKTGTKYVYIVRAYCGS
GSSKVYGEDSNQTAVTPTIAAPSEVSVENTTYNSITIKWGSMKGVEGYKVLRATSINGKY
KTVATVKGKSNHSYINKKLSAGTNYYYKVCAYKTVNGKKVNGLASEPLQISVVAPATTVK
SEAAGATAVKLTWTKVDLPSNGSGYNIYLVTNGNSRKVKSCKRKATSYTVKNLTPGENYT
FKVVPYTKNSKKKVVLGLDSNLLTATPTLLAPAIEKAASASDGTIQLTWKATGGGESGYE
VYRSTSKKKGYSLVGTAAVQSGVSEYAFEDANIVFGKKYYYKVRCTRTLENGTGMVSAYS
VVKTVKAGPAAPTLTVTASGSDQLKLSWKKVKMSSGGYVNGYVIYRSNTEKGTYKKVTTI
KSGKTTSYTDKGLVTGNTYYYKIRAYYKSGGKNVYSADSAIVSKQVTPSKPSVTAASLDY
QTIRVSWKQVTGASGYQIRRSETADGTYKSVKTINSASTLYFDNSKLTTGKTYYYKVRAF
VKKNGKKIYGEYSDVQSAAPVLGMPTNLAGTSIDNNQIKLTWTAVAGAKTYTILRSTSLT
GTYKIASEICDTNSFIDSNVSIGKTYYYKVQAIRDNLISDFTTPIAVTAAALELSTTSVT
MKTGTNMKITAKATPDAYVAWSSDNAQIAVVTSDGTIYALKAGTTTISATANNMTKKVTV
TVKDKLGTENKGLELSASNGTINFNNIKSAGYEYVMLRITNGTTEDKNFKTNLKNAKAAG
LKVGVICYSTAQTKTGAESEAKKVLSILNGEKLDYPVVYDLESEKLLYNNVTKTERVEFV
KAFQSQIVNAGKGYRFILGISQSLLKAYPEKYLDTSLLTGMDLWIYNCRAENLGHGYQGT
GNVVMWRYSDSATVDGVSGKVSISNRYKTY

Enzyme Prediction     

No EC number prediction in MGYG000000389_01976.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	1155	1337	4.8e-33	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	2.91e-37	1151	1347	2	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	1.39e-24	1151	1341	1	181	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
cd06525	GH25_Lyc-like	1.34e-18	1151	1341	1	179	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
pfam01183	Glyco_hydro_25	5.40e-13	1155	1337	3	180	Glycosyl hydrolases family 25.
COG3401	FN3	3.88e-11	527	870	7	330	Fibronectin type 3 domain [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL14028.1	0.0	129	1350	169	1396
VCV23482.1	0.0	129	1350	169	1396
QUO20801.1	3.75e-106	344	1350	149	1060
VCV20908.1	5.52e-91	233	979	565	1290
CBL07763.1	2.58e-88	233	979	559	1284

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q02388	2.34e-11	457	1053	290	847	Collagen alpha-1(VII) chain OS=Homo sapiens OX=9606 GN=COL7A1 PE=1 SV=2
P34020	6.50e-11	1151	1343	2	177	Autolytic lysozyme OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=lyc PE=1 SV=1
A2ASS6	1.41e-07	405	905	26694	27195	Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1
Q86VF2	1.50e-07	637	905	693	962	Immunoglobulin-like and fibronectin type III domain-containing protein 1 OS=Homo sapiens OX=9606 GN=IGFN1 PE=1 SV=2
Q97Z97	2.14e-07	776	945	312	463	Kelch domain-containing protein SSO1033 OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=SSO1033 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.007242	0.293040	0.698792	0.000373	0.000328	0.000215

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000389_01976.