CAZyme Information: MGYG000000390_00037

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae
• CAZyme ID: MGYG000000390_00037
• CAZy Family: GT4
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
282		32181.47	8.8297

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000390	2232010	MAG	Sweden	Europe

• Gene Location: Start: 10370; End: 11218 Strand: +

Full Sequence      

MLLFPAQNGLRVYAPLLSFFRRFFKDRKLHYIVIGGWLPQFLSKRKRLAKVLRRFDAIYV
ETNTMKGALEARGFHNVLVMPNCKKLTVLAEEDLVYPDSSPLRLCTFSRVMREKGIEDAV
NAVMAVNKELGYPAFSLDIYGQVDANQIEWFQNLQKTFPDYISYGGLIPFDKSVVTLKNY
FALLFPTYYEGEGFAGTLIDAYSAGIPVVASDWKYNPELVNENVGIIYPTGNEAALIEAL
KSIAADPETMLKRKKLCLKEAEKYKIEETVKVLFRQIESDKI

Enzyme Prediction     

No EC number prediction in MGYG000000390_00037.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	106	249	7.6e-16	0.875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	4.20e-20	29	271	112	359	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	1.21e-19	10	279	106	376	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam13692	Glyco_trans_1_4	9.29e-12	101	246	1	138	Glycosyl transferases group 1.
cd03823	GT4_ExpE7-like	1.46e-11	97	248	187	329	glycosyltransferase ExpE7 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. ExpE7 in Sinorhizobium meliloti has been shown to be involved in the biosynthesis of galactoglucans (exopolysaccharide II).
cd03808	GT4_CapM-like	3.10e-11	108	271	196	355	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCO04323.1	8.26e-119	1	273	69	340
QUF81615.1	2.36e-118	1	273	69	340
QBE94676.1	5.69e-97	1	278	69	343
AQW22832.1	1.11e-96	1	277	69	343
AXH51535.1	1.39e-95	1	277	71	345

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PQG_A	4.61e-06	101	268	328	490	Crystalstructure of the pneumococcal O-GlcNAc transferase GtfA in complex with UDP and GlcNAc [Streptococcus pneumoniae TIGR4],4PQG_B Crystal structure of the pneumococcal O-GlcNAc transferase GtfA in complex with UDP and GlcNAc [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9AET5	4.45e-06	54	215	271	427	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase GtfA subunit OS=Streptococcus gordonii OX=1302 GN=gtfA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000390_00037.