CAZyme Information: MGYG000000473_00013

Basic Information

• Species: UBA10281 sp900767495
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UBA10281; UBA10281 sp900767495
• CAZyme ID: MGYG000000473_00013
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399		45658.25	5.3624

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000473	1843328	MAG	Fiji	Oceania

• Gene Location: Start: 9402; End: 10601 Strand: -

Full Sequence      

MERVRVALIGVGGRGEGLYRVAMKMRTDLDFVAVVDPDQKMIDRIVKEMKDNGHGNPAVY
DDYRKCIDEIKPDAIVVATGWDMHLPVTKYAMEKGVAVALEVGGAYSIESLWELVRLYER
TKTPIMMMENCCYGRTELLALNMKRQGLLGDIIHVEGGYRHDLREEVTGVAMGRNHYRIN
EYIKRNCDNYPTHEIGPIAKLLDINCGNRFDYLVSTATSTHALETFVNERNIEDLQGVKF
NQADVVTTCIKCACGETVTITLDTCMPRYYSRAFLAQGTKGLICEENKSVYLERDNQGEV
WEWKDKFGNITEYYEKYDHPIWKDYKPCKEGHGGMDYLVFNAFFTALKEGKPMPIDVYDT
ATWMSVALLTEQSLLTGQRAVFPDFTEGKWINRKNEFEL

Enzyme Prediction     

No EC number prediction in MGYG000000473_00013.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	1	392	9.4e-133	0.9899749373433584

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	1.66e-19	1	379	1	337	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	4.81e-08	4	127	1	118	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK08618	PRK08618	0.003	7	79	131	200	ornithine cyclodeaminase family protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTH43530.1	3.67e-139	2	394	3	399
AVM42018.1	1.52e-134	1	391	1	397
QJD87109.1	5.02e-134	2	394	3	398
QTH41319.1	9.00e-134	2	397	6	404
QNK55026.1	5.76e-133	2	394	3	398

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	2.54e-86	2	399	19	440	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	2.74e-71	1	390	40	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4Q8F7	1.39e-85	2	399	19	440	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
B2FLK4	2.05e-84	2	397	32	448	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
A6LB54	4.94e-82	3	399	49	466	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1
A4Q8G1	2.90e-81	4	399	53	468	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
A1S4U5	2.36e-76	1	390	50	445	Glycosyl hydrolase family 109 protein OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) OX=326297 GN=Sama_1194 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000473_00013.