CAZyme Information: MGYG000001063_04858

Basic Information

• Species: Robinsoniella sp900540475
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Robinsoniella; Robinsoniella sp900540475
• CAZyme ID: MGYG000001063_04858
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
997	MGYG000001063_127|CGC1	114974.92	4.9185

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001063	7637037	MAG	Sweden	Europe

• Gene Location: Start: 2025; End: 5018 Strand: -

Full Sequence      

MEKTEGKMEGKIEDKIEDKIEDKIEGKIERKIEGKWIWISENRTSENERGCFTTEFYGVD
AHAADIHIADAHGMDSYAGTSSMEKDIKLMICGITRYIVYLNGKEMGRGPIRSGPGELFY
DTYDITPDVKPGRNFLAVRVWSYGWSTYQTVAQEGGVWFQVSSGGEVLAASGAETKCAKD
LGHISHTVKRNVNLGFSDYYDANRFDSRWIEDGEISKDWGTAWVLEDGENREDREVRIKQ
NPLRQFQRTAKTPGKIVRIQEVIPGCQQISVNTRNAFFPGRKDADETIFSGFLGCEFLAP
QDMEGMIAFPNRTWNGIIGDFTIDGKLYEVSNEHREIPVRLCEGKHFFLMQISGKFDDLY
CHMELCFPENLIMEGDFFVKGPTSRIVPVIDGFGKVYGGLDEYNRLEKYPDIHKRLFAAS
SLKEMVEIGGPVTYVEPRYIYENAYIYSLAKRDKVIAESAVQPRHLGMLWDNQEVTRIDP
PASGGWNRIIVDFLDIYVGSLEFTIKAPAGAILDIYCFENMYQGEIDYTIGLNNSVRYIC
KEGWQSYRCMARIGMRYAMLTFQECREEVRIRDFRINYATYAPGNLGDFTCDDYLLNRIF
EMCRHTHQLCMEDSFTDCPTYEQSFWIGDAGISAVTCAYLFGDYDLIKRSIQLSAEARAN
TPLLNALTPTDWNTSIPMWTMNWIISIFQYAKVSGDTKIFPEMYGVVKETLKYYAGFIQE
DGGFLINAWNMMDWADMDIHNYGIVTGQQAVLAYCFGLAAAYAEKNKYEKDVAFFEECQM
RLLLYMETKLWDSNHKMFRDGFSPEYGMSRTFSIQTHILMLLYDGILDVEKKFIVENYIT
DPPVEMIQAGSPFMLYYQYECLAKKGRVQEIMDDIKIRWGEMLKYDSTTCWEVFPGFYEV
SRTRSYCHSWSASPAYFFIKYALGVQMLEDGFAKIEIKEPAWDMKWCRGDVPTPHGAIHI
EWIREDGRKECRVRIPKKIQVVYEENSDCEVRIHRIG

Enzyme Prediction     

No EC number prediction in MGYG000001063_04858.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	488	980	2.1e-86	0.9742063492063492
CBM67	85	226	4.6e-18	0.7897727272727273

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	4.24e-31	587	921	4	339	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.66e-05	924	991	1	61	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	0.003	487	561	6	85	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNK57954.1	2.68e-209	34	995	5	954
AEE96402.1	1.24e-172	86	977	35	923
QJD85544.1	3.51e-144	35	993	8	952
BBH22139.1	2.93e-142	35	993	9	954
BBH22121.1	8.45e-141	35	993	9	954

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	1.29e-131	36	981	10	937	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
3CIH_A	1.68e-34	554	960	272	674	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	6.26e-23	487	923	93	543	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	2.81e-07	482	976	380	897	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000080	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001063_04858.