CAZyme Information: MGYG000001131_01429

Basic Information

• Species: Prevotella sp900543585
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900543585
• CAZyme ID: MGYG000001131_01429
• CAZy Family: GH26
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378	MGYG000001131_59|CGC4	42901.09	5.9454

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001131	3153631	MAG	China	Asia

• Gene Location: Start: 64963; End: 66099 Strand: -

Full Sequence      

MHKIITFFVILLFCCSCSKAEQPTDSTGLGQNAGTITTFSPDKLCNPQADAATQKVYNIL
CQLYGSHIISGTVANVDWNTREAENVKSWTGKYPALNAFDFINFHSSKDVNAKGWLDYAD
ISPVKRWWNEGGLVSCMWHWQVLANNGTDYTCSPGNGDKETSINLNDIDNPSSSTYKQLI
KDMDQIAGYLGKLQAAGIPVIWRPLHEAAGNTYEFDGGRAWFWWGAQGAEPFKKLWRLMY
DRFTRVHHLNNLIWVWTSQTADESWYPGDDVVDIIGRDRYGLLQYPAMKDFKNLTSAYPH
KLITLAECGNGDSNDIAPLGKIWDKGAHFSWFMTWYDYDYNNGKGADHRFAGAAWWKDAF
SHDYVVTRDEMKSLLQAE

Enzyme Prediction     

EC	3.2.1.78

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	46	370	1e-89	0.9933993399339934

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	2.30e-50	46	370	2	311	Glycosyl hydrolase family 26.
COG4124	ManB2	3.62e-12	176	282	160	258	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRX62597.1	5.27e-109	20	374	92	448
AHW58761.1	2.79e-100	46	374	49	369
ARK08557.1	1.00e-96	44	374	142	455
QIK58757.1	2.83e-96	44	374	142	455
QIK53340.1	2.83e-96	44	374	142	455

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HF2_A	2.18e-86	1	373	1	358	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6D2X_A	6.87e-77	44	371	4	334	Crystalstructure of the GH26 domain from PbGH26-GH5A endo-beta-mannanase/endo-beta-glucanase from Prevotella bryantii [Prevotella bryantii B14]
6D2W_A	1.59e-72	44	371	95	425	Crystalstructure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14],6D2W_B Crystal structure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14]
3ZM8_A	1.03e-53	44	372	145	448	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
3WDQ_A	3.07e-51	47	371	37	352	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49425	1.89e-53	41	337	143	431	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
G2Q4H7	2.67e-50	44	372	174	477	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
Q5AWB7	4.13e-38	29	335	17	319	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
A2R6F5	5.23e-38	26	335	14	302	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
P55298	3.04e-37	44	373	156	461	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000477	0.474710	0.524201	0.000217	0.000208	0.000176

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001131_01429.