CAZyme Information: MGYG000001312_01767

Basic Information

• Species: Helicobacter_D pullorum
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Helicobacteraceae; Helicobacter_D; Helicobacter_D pullorum
• CAZyme ID: MGYG000001312_01767
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359	MGYG000001312_44|CGC3	40954.61	8.8869

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001312	1919109	Isolate	not provided	not provided

• Gene Location: Start: 307759; End: 308838 Strand: +

Full Sequence      

MKVVITGGGTGGHLSVAKAFLEEFDKRGYECIFVGSMGGQDRVYFGDDNRFAKKYFLQTK
GVVNQRILGKIGSLFQHFKAFIEALKILKQERVDFVLSVGGYSAAPAAFGAVFLRLPLII
HEQNARIGRLNNLLKPYAAVFFSSYLETSPIKFYPVRKEFFEYSRVRERVDKILFIGGSQ
GARAINNFALSMAMDLQKRGIKIFHQCGKNDFQRVLEEYHKLPLKIKILETMEDLKDDFD
VLLFDFSKNMPKIFEACDFAVSRAGASSLWELCANGIVTLFVPYPYAAGNHQYFNAKFLE
DKELGFLCEEKDLYCDVLWNILELLTQRTLSKMSRELQRETHIGATGQMVDCILERIKK

Enzyme Prediction     

No EC number prediction in MGYG000001312_01767.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	173	339	5.4e-41	0.9490445859872612

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	2.85e-103	13	359	14	357	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
TIGR01133	murG	1.58e-84	1	353	1	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
cd03785	GT28_MurG	2.17e-84	13	351	12	349	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	1.87e-73	13	359	13	357	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
pfam04101	Glyco_tran_28_C	7.39e-33	173	313	2	128	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEJ07833.1	1.24e-260	1	359	1	359
AWI34126.1	8.19e-171	1	357	1	357
QOQ97432.1	1.21e-149	1	357	1	369
AXH10576.1	6.37e-111	2	359	4	343
AXX93279.1	1.24e-110	2	355	4	339

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7D1I_A	7.61e-42	3	353	12	362	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
3S2U_A	8.23e-30	2	355	4	353	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
1F0K_A	1.26e-25	2	351	8	348	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7MAD4	2.15e-108	1	354	1	335	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) OX=273121 GN=murG PE=3 SV=1
Q30PK0	6.83e-103	1	354	1	336	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) OX=326298 GN=murG PE=3 SV=1
A8FM88	1.08e-99	1	350	1	330	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) OX=407148 GN=murG PE=3 SV=1
A1W027	1.24e-98	1	350	1	330	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) OX=354242 GN=murG PE=3 SV=1
Q9PNQ2	1.24e-98	1	350	1	330	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001312_01767.