CAZyme Information: MGYG000001333.1_00848

Basic Information

• Species: Lentilactobacillus hilgardii
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lentilactobacillus; Lentilactobacillus hilgardii
• CAZyme ID: MGYG000001333.1_00848
• CAZy Family: CBM50
• CAZyme Description: Vitamin B12 import ATP-binding protein BtuD

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357		40471.63	7.5609

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001333.1	3077266	Isolate	not provided	not provided

• Gene Location: Start: 587310; End: 588383 Strand: -

Full Sequence      

MEENYKVKVQNVTKEYDLFKTQSEKLRSFFAISKHQIPHFWSLMGISLTIQPGETLGLIG
VNGSGKSTLSNIISGIIPQTTGYVDVRGDTSIVAIHAGLRNNLTGRENIRLKSLMQGLTN
EEIDEMMPDIIAFADIGDFVDQPVKSYSSGMRSRLGFAIAVHINPDILIIDEALSVGDDT
FYQKCVDKITEFKQEGKTIIFVSHSLKQIEMLCDKVAWINYGELKMVGETKEVTTKYREF
TKWFKKLSKKEKHDFETERKNVQKNFSIQNYQKQVTEEMQKAAPQEKNVHSKVHRLFYSS
VISEKMSVGNQLLTWAVLLVVIFFCLVNISGYSVGHVLNDPSLLMHPSDVLHLPDAK

Enzyme Prediction     

No EC number prediction in MGYG000001333.1_00848.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1134	TagH	6.32e-104	6	248	3	249	ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
PRK13545	tagH	5.78e-102	4	289	2	291	teichoic acids export protein ATP-binding subunit; Provisional
PRK13546	PRK13546	8.07e-97	4	265	2	259	teichoic acids export ABC transporter ATP-binding subunit TagH.
cd03220	ABC_KpsT_Wzt	3.10e-95	7	228	1	224	ATP-binding cassette component of polysaccharide transport system. The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export. Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters. A typical system is made of a conserved integral membrane and an ABC. In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenza) and a cytoplasmic membrane protein MPA2.
COG1131	CcmA	5.57e-45	7	278	5	269	ABC-type multidrug transport system, ATPase component [Defense mechanisms].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBD25608.1	1.07e-107	1	351	1	344
AUC58829.1	1.07e-107	1	351	1	344
QPB60328.1	1.07e-107	1	351	1	344
AYZ07349.1	1.07e-107	1	351	1	344
QCJ67441.1	1.07e-107	1	351	1	344

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7DD0_A	5.22e-108	6	264	4	260	Crystalstructure of the N-terminal domain of TagH from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],7DD0_B Crystal structure of the N-terminal domain of TagH from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],7DD0_C Crystal structure of the N-terminal domain of TagH from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],7DD0_D Crystal structure of the N-terminal domain of TagH from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168]
6JBH_A	5.79e-92	9	255	7	252	Cryo-EMstructure and transport mechanism of a wall teichoic acid ABC transporter [Alicyclobacillus herbarius],6JBH_B Cryo-EM structure and transport mechanism of a wall teichoic acid ABC transporter [Alicyclobacillus herbarius]
6AMX_A	5.32e-57	7	237	1	231	CrystalStructure of Nucelotide Binding Domain of O-antigen polysaccharide ABC-transporter [Aquifex aeolicus VF5],6AN5_A Crystal Structure of The Nucelotide Binding Domain of an O-antigen polysaccharide ABC-transporter [Aquifex aeolicus VF5],6AN5_B Crystal Structure of The Nucelotide Binding Domain of an O-antigen polysaccharide ABC-transporter [Aquifex aeolicus VF5],6OIH_A Crystal structure of O-antigen polysaccharide ABC-transporter [Aquifex aeolicus VF5],6OIH_B Crystal structure of O-antigen polysaccharide ABC-transporter [Aquifex aeolicus VF5]
6M96_A	1.59e-56	7	237	3	233	ATP-boundconformation of the WzmWzt O antigen ABC transporter [Aquifex aeolicus VF5]
7K2T_A	1.18e-54	7	237	3	233	ChainA, ABC transporter [Aquifex aeolicus VF5],7K2T_C Chain C, ABC transporter [Aquifex aeolicus VF5]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q03SI5	4.55e-174	1	356	1	356	Teichoic acids export ATP-binding protein TagH OS=Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947) OX=387344 GN=tagH PE=3 SV=1
Q88ZH4	3.42e-143	1	347	1	348	Teichoic acids export ATP-binding protein TagH OS=Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) OX=220668 GN=tagH PE=3 SV=1
Q831L8	3.04e-108	1	351	1	344	Teichoic acids export ATP-binding protein TagH OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=tagH PE=3 SV=1
Q65E84	6.21e-107	6	258	4	254	Teichoic acids export ATP-binding protein TagH OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=tagH PE=3 SV=1
Q8Y843	1.19e-106	1	264	1	264	Teichoic acids export ATP-binding protein TagH OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) OX=169963 GN=tagH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
312	334