CAZyme Information: MGYG000001346_00670

Basic Information

• Species: Bacteroides uniformis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides uniformis
• CAZyme ID: MGYG000001346_00670
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
685		77811.07	5.0613

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001346	4452540	Isolate	not provided	not provided

• Gene Location: Start: 71588; End: 73645 Strand: +

Full Sequence      

MKNLYTWVAALLFVALTVSVTACTSASSAGTVTVVDRPDTHAVNANYMGYRAPLRPLNFI
KLPVGSIRPEGWVRKFLELQRDGLTGHLGEISAWLEKDDNAWLTTGGDHGWEEVPYWLKG
YSSLAYILNDPEMIEETKYWIEGVFASCQPDGYFGPVNERNGKRELWAQMIMLWCLQSYY
EYSQDRRVIDLMTNYFKWQMTVPDDRLLEDFWENSRGGDNIISIYWLYSHTGDAFLLELA
EKIHRNTADWTQSTSLPNWHNVNIAQCFREPATYYMQTGDSAMLKASYNVHRLIRRTFGQ
VPGGMFGADENARLGYIDPRQGVETCGLVEQMASDEIMLRMTGDPLWAEHCEEVAFNSYP
VAVMPDFKALRYITCPNHVVSDSKNHHPGIDNRGPFLSMNPFSSRCCQHNHAQGWPYFAE
HLVLATPDNGVATALYAACKAVVKVADGKEITLHEETNYPFEEDIRFSVSTGGKVVFPFY
FRIPSWTQKAKVRVNGEEVDAAPVAGKYLCIHREWSDGDRVELTFPMSLSMRTWQVNKNS
VSVDYGPLTLSLKIAEKYVEKDSRETAIGDPKWQKDADPQKWPTTEIYPGSAWNYSLVLD
KTEPLKHFEVIRKSWPADDYPFTVANVPLEVKAVGRLVPEWEIDETGLCGVLPEEDAARG
DKEEITLIPMGAARLRITAFPNTKE

Enzyme Prediction     

No EC number prediction in MGYG000001346_00670.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	323	549	4.7e-33	0.4217557251908397

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.51e-156	32	551	2	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	4.88e-24	110	594	57	574	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWL89945.1	2.02e-173	38	681	31	665
QXQ95199.1	5.53e-173	38	681	31	665
APS23119.1	5.69e-173	38	681	31	665
QNQ38172.1	4.89e-171	38	681	31	665
QKW18167.1	1.29e-170	47	683	51	670

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	5.97e-22	113	571	78	587	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	3.03e-20	113	571	78	587	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	8.17e-17	324	553	381	609	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
6EX6_A	1.65e-12	260	527	247	517	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000005	1.000046	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	29