CAZyme Information: MGYG000001346_01687

Basic Information

• Species: Bacteroides uniformis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides uniformis
• CAZyme ID: MGYG000001346_01687
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
332		37854.4	9.434

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001346	4452540	Isolate	not provided	not provided

• Gene Location: Start: 272605; End: 273603 Strand: -

Full Sequence      

MTKFLIIRFSSIGDIIQCMGIIGGIRERFADVEIHWITRKDMVGPLSMDGRIDKIWAFDK
ETGLAGLLKMAADLRKEHFDYIYDAHSNIRSNILKLIVSPLPFVKPYVALRSKERGKRFL
LFKLGINHFDKPFRGMVSFQKPLKKWGITHFPDNYHDWHFPDEIRSKYENFVTKDMITLV
PSANWEMKRWPVSYWKELVALLPEYKFVILAGPKDTFCEEIRSAAPERVVNLAGQTSLME
SSYIVLRSNLVISADTGFMHAADLFRVPAFALMGPTAFGFPTGPTVEILETALPCRPCTK
DGRGKCRLAVYQKCMVDITPQQVAEKIIASLG

Enzyme Prediction     

No EC number prediction in MGYG000001346_01687.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	69	303	2.6e-36	0.9466666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	4.74e-46	3	327	1	275	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	1.01e-41	1	329	1	328	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	5.48e-16	181	298	112	236	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10916	PRK10916	3.24e-11	188	323	195	335	ADP-heptose--LPS heptosyltransferase RfaF.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT65908.1	2.37e-249	1	332	1	332
QUU01344.1	2.37e-249	1	332	1	332
ALB75767.1	2.37e-249	1	332	1	332
QMI80021.1	2.37e-249	1	332	1	332
QBJ18616.1	4.58e-247	1	332	1	332

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1PSW_A	3.97e-07	188	331	195	343	Structureof E. coli ADP-heptose lps heptosyltransferase II [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q57336	2.22e-15	6	272	13	280	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1
P37692	9.02e-08	174	331	180	343	ADP-heptose--LPS heptosyltransferase 2 OS=Escherichia coli (strain K12) OX=83333 GN=rfaF PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001346_01687.