CAZyme Information: MGYG000001354_00959

Basic Information

• Species: Bifidobacterium dentium
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium dentium
• CAZyme ID: MGYG000001354_00959
• CAZy Family: GT2
• CAZyme Description: UDP-Gal:alpha-D-GlcNAc-diphosphoundecaprenol beta-1,3-galactosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
312	MGYG000001354_1|CGC26	35455.67	7.9616

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001354	2642081	Isolate	not provided	not provided

• Gene Location: Start: 1174386; End: 1175324 Strand: -

Full Sequence      

MIYDSVVTIQQHDQLPQFSLLMSVYANDSLPQVERAIASATVEQSLPPTQIVIIRDGRVP
DDIARFLQGLPETVADWFSRSGVSLRPRPEVTVVPLEVNQGLAHALNEGLRRCRYDVVAR
ADSDDISLPERFATMMPLFAADRAPAIDIAGSAIQEFTGEENRNGQVRTLPREGAELERF
ARMQSPLHHPSVVFRKSVVLAAGGYPEHVGRFEDYMLWEQLMLRHARFYNVPEALVLYRV
DAGAYQRRGGLGMFRDELQLQLKFLHDDFVSLPQFLRNVLVRAVYRLLPTSFRKSCYHLL
VAVRNRLTGNRK

Enzyme Prediction     

No EC number prediction in MGYG000001354_00959.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04195	GT2_AmsE_like	1.76e-68	19	239	1	201	GT2_AmsE_like is involved in exopolysaccharide amylovora biosynthesis. AmsE is a glycosyltransferase involved in exopolysaccharide amylovora biosynthesis in Erwinia amylovora. Amylovara is one of the three exopolysaccharide produced by E. amylovora. Amylovara-deficient mutants are non-pathogenic. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd00761	Glyco_tranf_GTA_type	9.65e-12	33	229	12	155	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd06433	GT_2_WfgS_like	1.50e-11	33	247	13	202	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd06423	CESA_like	5.87e-11	33	208	12	175	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
pfam00535	Glycos_transf_2	6.09e-11	19	199	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEG24587.1	3.02e-226	1	312	1	312
ADB10610.1	3.02e-226	1	312	1	312
QTL77682.1	1.18e-223	1	312	1	312
QTL79535.1	7.96e-222	1	312	1	312
BAQ27916.1	1.28e-221	7	312	1	306

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q03084	3.32e-40	13	297	3	267	UDP-Gal:alpha-D-GlcNAc-diphosphoundecaprenol beta-1,3-galactosyltransferase OS=Escherichia coli OX=562 GN=wbbD PE=1 SV=1
Q46635	2.34e-37	18	297	2	260	Amylovoran biosynthesis glycosyltransferase AmsE OS=Erwinia amylovora OX=552 GN=amsE PE=3 SV=2
Q48215	3.22e-32	17	297	2	261	Uncharacterized glycosyltransferase HI_1695 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1695 PE=3 SV=2
Q4KXC9	2.78e-12	15	247	6	216	O-antigen biosynthesis glycosyltransferase WbnJ OS=Escherichia coli OX=562 GN=wbnJ PE=1 SV=1
P71054	7.50e-08	91	248	63	216	Putative glycosyltransferase EpsE OS=Bacillus subtilis (strain 168) OX=224308 GN=epsE PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001354_00959.