CAZyme Information: MGYG000001408_00767

Basic Information

• Species: Brevibacterium senegalense
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Brevibacteriaceae; Brevibacterium; Brevibacterium senegalense
• CAZyme ID: MGYG000001408_00767
• CAZy Family: GT39
• CAZyme Description: putative dolichyl-phosphate-mannose--protein mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
540		59947.9	9.4393

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001408	3398887	Isolate	not provided	not provided

• Gene Location: Start: 167749; End: 169371 Strand: +

Full Sequence      

MTATPTDRREPSASAQQPALQALAVRFPPSVLGWLLPALIAAVGGILRFIRLGEPGTLIF
DETYYVKEGWSLTQFGYEREWPEEPNPAFEAGDPWGVLETGDFIVHPPLGKWMIGAGIQL
FGQDSSMGWRFAAAVVGTLSILIVGLIAWRMFRSAWLAAIASLLLAVDGEHLVHSRTSLL
DVFLMFFVLLAFWLLIEDRVRTRSRIEAGLDAAGLGAPPGRLGAVMGARPAWFLPAAWGP
SLGTRPYRLAAGLALGCAMGVKWSGLYALAVFGLLTVAWDWGHRRRMGVRKPWLAALLKD
APPAFVSLVPVALVVYVASWTGWIVTRGGYYRDWAETNSGWWDFLPDWIPSLAKYHRAAY
DFHVGLASEHTYMSNPWGWIVQWRPTSFYYQTAEQGQHGCAVEQCSAAITSVGNPVIWGL
APVAVLLLVFAWLLRRDWRAGALLAALIATWGPWFTYQERTIFTFYTIVMVPFVVLALTY
GLGLVWGRAGQGPALRARRVGVGVVLALAVLAFAFFWPVWTATYIPRDAWQLRMWNPTWI

Enzyme Prediction     

No EC number prediction in MGYG000001408_00767.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	40	323	1.5e-75	0.9865470852017937

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1928	PMT1	5.24e-19	35	281	25	228	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam16192	PMT_4TMC	4.08e-09	355	535	6	196	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
COG4346	COG4346	1.55e-07	106	478	136	405	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].
pfam02366	PMT	2.08e-07	103	285	42	204	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG1807	ArnT	0.008	29	216	2	172	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIN29095.1	1.82e-227	2	540	39	568
AZT99217.1	3.67e-211	34	539	37	582
SDS81033.1	4.89e-211	34	539	119	662
AZT94457.1	7.76e-211	34	539	110	655
AZL11291.1	2.10e-210	34	539	37	582

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L8F4Z2	3.74e-86	1	539	1	515	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
P9WN04	7.76e-83	33	539	43	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	7.76e-83	33	539	43	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
Q8NRZ6	4.73e-68	38	539	39	519	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1
Q9UKY4	2.60e-08	13	281	37	262	Protein O-mannosyl-transferase 2 OS=Homo sapiens OX=9606 GN=POMT2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000035	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
30	52
127	149
156	173
177	196
263	282
302	324
412	434
438	455
462	484
499	521