CAZyme Information: MGYG000001410_00132

Basic Information

• Species: Sutterella wadsworthensis_A
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Sutterella; Sutterella wadsworthensis_A
• CAZyme ID: MGYG000001410_00132
• CAZy Family: GH8
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361	MGYG000001410_1|CGC3	40205.74	4.8959

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001410	2665472	Isolate	not provided	not provided

• Gene Location: Start: 166027; End: 167112 Strand: -

Full Sequence      

MFKKMIISAALACAFCSASSAMAAWPVWDEFRNDALDNGRVVDKSDDRKVTTSEGQSYAM
FFALVTNDQVTFDGLAAWTADNLSGGDLTKTLPAWLWGRGRGDKWGILDTNNATDSDMWI
AWCFLEAGRLWKSEEYTKKGMAMLELLKKEVRTVDNLGSVVLPGRVGFEDNGTVKLNPSY
YPLFLFKRFALEDAYWNEVYEGSLRMLLRSSPAGIAPDWALFDKGGRLVPPNGDDYEIGS
YNAIRTYLWAGMMSPDDPNRAILMKHFSPMVEATRALNMPPEKIHTVNLTVNDTGPFGFG
ACLIPMLGNDRTAGLVRSVVDSERLSGESYYSSMLALYGRGWDEGRFAFDADGRLIFPKG
R

Enzyme Prediction     

No EC number prediction in MGYG000001410_00132.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	25	342	4.9e-77	0.99375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11097	PRK11097	1.52e-152	4	356	2	365	cellulase.
COG3405	BcsZ	2.20e-82	15	349	14	350	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
pfam01270	Glyco_hydro_8	2.63e-60	23	345	2	321	Glycosyl hydrolases family 8.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQS88762.1	8.28e-167	13	359	14	363
QDA53874.1	2.28e-166	3	356	2	359
QDA53782.1	3.71e-112	25	360	71	412
ANU67169.1	1.03e-110	24	359	21	352
QQQ96024.1	1.03e-110	24	359	21	352

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QXQ_A	1.47e-98	25	356	4	336	Structureof the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_B Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_C Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_D Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12]
4Q2B_A	5.08e-95	24	356	3	340	Thecrystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_B The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_C The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_D The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_E The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_F The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440]
7F81_A	1.74e-93	19	355	2	339	ChainA, Glucanase [Enterobacter sp. CJF-002],7F81_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F81_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F81_D Chain D, Glucanase [Enterobacter sp. CJF-002]
3QXF_A	1.98e-93	25	356	4	336	Structureof the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_B Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_C Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_D Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12]
7F82_A	4.94e-93	19	355	2	339	ChainA, Glucanase [Enterobacter sp. CJF-002],7F82_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F82_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F82_D Chain D, Glucanase [Enterobacter sp. CJF-002]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8X5L9	9.41e-100	21	356	21	357	Endoglucanase OS=Escherichia coli O157:H7 OX=83334 GN=bcsZ PE=3 SV=1
Q8ZLB7	1.38e-99	19	356	20	358	Endoglucanase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsZ PE=3 SV=1
Q8Z289	2.76e-99	19	356	20	358	Endoglucanase OS=Salmonella typhi OX=90370 GN=bcsZ PE=3 SV=1
P37651	1.52e-98	21	356	21	357	Endoglucanase OS=Escherichia coli (strain K12) OX=83333 GN=bcsZ PE=1 SV=1
P58935	3.11e-85	7	356	15	372	Endoglucanase OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002230	0.726209	0.270346	0.000489	0.000359	0.000336

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001410_00132.