CAZyme Information: MGYG000001420_03147

Basic Information

• Species: Alistipes senegalensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes senegalensis
• CAZyme ID: MGYG000001420_03147
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
677		73597.84	5.8976

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001420	3985129	Isolate	not provided	not provided

• Gene Location: Start: 1727476; End: 1729509 Strand: +

Full Sequence      

MLLGGLQMALAPVSAQTCRERAESLVSKMTLEEKASLVSGQVDGFHTAAIPRLGIPSIRM
ADGPQGVRNKTRSTFYPCGISLASTWNPDLAREMGRGLALDARARGIGIMLGPGVNIYRS
ALCGRNFEYYGEDPVLASAIACGYIEGMQQNGVIATIKHFAANNQEYRRHATNSVVDERT
LRELYFPVFKDAVQKAGVGAVMTSYNPLNGIHSAENRWLITDVLRKEWGFDGIVMSDWTS
TYTTLGCMESGLDLEMPKGYWLNYKMIRELLDRGIVHERQLDEKCVHILSTLIRFGLLDR
PAVDSALPLDNEECRRIAYATALEGPVLLKNAGALPLDRAALKRVAVIGPNADRIPFGGG
SGEVTPIEGCSTTLFSGLCAVAGREHVDTIRFGADGSFDEKAVSRASAVVVSVGFTKETE
GEGFDRTFSLPEGQDELIRRVAGLNDRVVVVVNSGGEVAMPWLDEVEAVVMAWYPGQEGG
RALASILSGMESPSGRLPVTFWGTLEGNPAAVYYGMRKNEIVPQKRDPFCHTVYYEGLFS
GYRAAGSAGFAPLFPFGFGLTYSLFAYSDLSIQPAADGYDVSFWVRNVGKCRAADVPQVY
VSECNPREPRPAKLLKGFAKVTLSADEKTRVSVHLGKDAFSHYDVASGEFRVSPGVFEVI
VGANAREESLKTSLTIE

Enzyme Prediction     

EC	3.2.1.21	3.2.1.37	3.2.1.23	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	48	257	2.5e-71	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	2.01e-83	2	662	18	751	beta-glucosidase BglX.
COG1472	BglX	4.94e-81	46	353	51	365	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	1.03e-61	21	571	52	642	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	9.51e-55	327	542	2	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	2.68e-49	52	290	63	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT99859.1	2.37e-200	3	676	9	820
QQA31227.1	2.37e-200	3	676	9	820
QUT62810.1	2.37e-200	3	676	9	820
BBK88877.1	2.37e-200	3	676	9	820
QUT34425.1	2.37e-200	3	676	9	820

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	1.29e-140	23	676	6	668	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	8.41e-117	26	677	9	664	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	4.95e-109	20	676	2	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	7.43e-108	20	676	2	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
4I3G_A	4.42e-90	1	676	29	826	CrystalStructure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	7.04e-140	23	676	6	668	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
P27034	6.61e-129	23	665	3	799	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
E7CY69	1.14e-114	26	667	9	663	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
F6C6C1	2.58e-112	26	677	9	673	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
A7LXS8	1.09e-111	16	677	40	744	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.723692	0.275555	0.000312	0.000227	0.000113	0.000120

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001420_03147.