CAZyme Information: MGYG000001745_01607

Basic Information

• Species: Coprococcus sp900548215
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Coprococcus; Coprococcus sp900548215
• CAZyme ID: MGYG000001745_01607
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
313	MGYG000001745_8|CGC1	36265.73	4.7379

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001745	2913085	MAG	Sweden	Europe

• Gene Location: Start: 32669; End: 33610 Strand: +

Full Sequence      

MQKAANKHISHSAQNLLDYLSEISGKKIITGQHTQTNPMEEIDYIYEQTGKYPALRGFEL
LGYSPNINYNDASAECLTEVYENQNTLDTALEWAKKTNGIVTFTFHWFSPIGGRDKSFYT
EHTDFDAEKVLIPGTRERDAFYHDMDIIAKELRRFQLEDIPVLWRPFHESEGTWFWWGAK
GPAVAAKLYRLMFDYYTNVLNINNLIWVWNCPTKGVYPGDDFVDIVSMDIYLPEYTATDY
SEEYTKLVEATSPNKVAALTEVGYIPDIHLLEKSHTPWAYYMTWSEKFCIGEKFNSNENL
KAMYDSQYAVTGK

Enzyme Prediction     

No EC number prediction in MGYG000001745_01607.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	6	311	8.7e-100	0.9834983498349835

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	6.62e-52	6	311	2	308	Glycosyl hydrolase family 26.
COG4124	ManB2	1.22e-13	160	264	180	297	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK82137.1	2.16e-240	1	313	1	313
QNM01251.1	2.97e-158	5	311	9	333
AEB13973.1	1.98e-155	1	311	1	309
AZK45707.1	1.44e-129	6	311	8	313
QUL56288.1	5.72e-125	6	311	11	316

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPF_A	2.04e-63	6	311	8	306	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3ZM8_A	3.55e-57	6	311	147	443	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
3WDQ_A	8.13e-50	10	311	40	348	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6HF2_A	7.39e-40	10	312	51	349	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6Q75_A	5.42e-38	6	311	25	323	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	4.07e-62	6	311	176	472	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
Q5AWB7	6.75e-56	3	311	27	346	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
A2R6F5	1.62e-47	6	310	30	328	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
P49425	1.69e-47	12	311	154	453	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
P55298	1.35e-41	12	304	164	448	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001745_01607.