CAZyme Information: MGYG000001951_00003

Basic Information

• Species: CAG-873 sp900548975
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp900548975
• CAZyme ID: MGYG000001951_00003
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
859		95751.84	4.6508

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001951	2929441	MAG	Denmark	Europe

• Gene Location: Start: 1749; End: 4328 Strand: -

Full Sequence      

MKRIYMSTVAVAALALASCTGNSVSNLRCEYLTDPVGIDEQAPRFTWTVARQSAPYVVEV
AETPEDLKANKLIWQSEELPASTLSAVYTGPALKSHHRYAWRVASGDNTSDAASFETAKM
TPADWQASWISDTLDMEYEPAPMLRKEFKLDKVPAQARAYISTNGYYELWINGERVGDSH
MDPGFTHYDKRNLYATYDVTDLLNEGDNTVAAVLGNGFANCQSKAVWDYERARWRRRPAM
IFELREPDAAEAIVVSDSTWRTATGPYTYNNIYSGDRYDARLEPAGWRKPGFDDSAWSAA
AAVEDPSPLLKAQAMPAIRPVEVIEPKLLSNFGDTVYVFDMGKNIAGVSSLEVAGENGTH
FRMSHGEMLKDDGRLQQGNIDVYYRPQKPGEKFQTDEFILAGTGKPESFRPGFTYHGFRY
VEVAADRPVKLTSDNVKGYFMHTDVQPVGSFESSEPLLGKIYDATMLSYVDNLHSIPTDC
PQREKNGWTADAHVAIDLALQNYDGITLYEKWMNDFADNQRDNGNIAGIIPSCGWGYGNW
PGPVWDAALFVIPEALYNYYGDSRAIERMYPVMEKYFEWARSNEKPDGLFTDGIGDWLSY
SAQTPTDYTSSVYYYLDNVRMARFADMLGRDAAPYRAKAEALRDTINARWFDEEAATYAN
GSQAALGVALASGIVPEGKEKAVAETLHKTVEANDYFLDYGLLGSKTVPAMLTRYGYVDD
AYKMATKTDAPSWGYWLEKCGYTTLAETWTLSPEFHDASLNHVFMGDICSWMRTDLAGIN
YDPAKPGFENIIVRPHYPSGLESASATYNSVRGDISSSWTRKGNDIRLTVTVPGASTATV
YAPEPVEVGEGTHTFKFSI

Enzyme Prediction     

No EC number prediction in MGYG000001951_00003.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	333	841	5.1e-149	0.9880952380952381
CBM67	127	305	2e-43	0.9602272727272727

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	5.52e-100	448	772	3	336	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	2.27e-57	152	322	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.27e-26	333	442	4	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	2.17e-15	778	855	1	78	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
PRK10137	PRK10137	2.15e-05	595	727	566	738	alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX67103.1	0.0	10	859	9	858
QUR50486.1	0.0	10	859	16	865
QJE27359.1	0.0	10	857	9	856
QUT54420.1	0.0	10	859	11	860
QKH99925.1	0.0	10	859	11	860

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	7.29e-135	26	847	34	903	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	3.34e-113	141	843	302	995	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	4.53e-99	23	855	3	863	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	5.75e-113	33	833	41	897	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	1.43e-112	141	843	302	995	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	9.31e-100	30	853	38	889	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KNB2	2.78e-98	15	843	22	879	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000001	0.000490	0.999563	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001951_00003.