CAZyme Information: MGYG000001983_02424

Basic Information

• Species: Dysosmobacter sp000436875
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; Dysosmobacter; Dysosmobacter sp000436875
• CAZyme ID: MGYG000001983_02424
• CAZy Family: GH18
• CAZyme Description: Putative sporulation-specific glycosylase YdhD

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
276		29900.55	4.3763

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001983	2532664	MAG	Spain	Europe

• Gene Location: Start: 74; End: 904 Strand: +

Full Sequence      

MTSAGGALNLSVYMDAGDGVRDLLTSADGRSQAVGQIVNELTVTYKTLGRNPYDGVTIDF
EGLRSAQKADFTAFLTELADAVHGMDKTLYVCVSPVLLSGSYYDGYDYGAIGALADKVIL
MAYDYEARDMSDFVGTEYYKTAATVPLDQVFLGLSALKYQGVATDKIVLGLSCKNVAWKI
DGAGKMVSGAPVSVSNETLHQRLAQSDTVKGWSDTYQQSYAVYSTEDGSRYFVWYQDGAS
ITRELETAKLLGISGVSLWRLGTIPAYSDWSWTNAL

Enzyme Prediction     

No EC number prediction in MGYG000001983_02424.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	3	262	1.2e-30	0.7263513513513513

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	4.37e-31	16	262	74	303	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	2.06e-23	45	262	200	408	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
cd06549	GH18_trifunctional	1.45e-20	17	263	76	292	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
pfam00704	Glyco_hydro_18	2.09e-14	15	259	74	302	Glycosyl hydrolases family 18.
smart00636	Glyco_18	1.41e-13	15	259	77	329	Glyco_18 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAK99492.1	1.05e-118	5	276	295	569
QNL45580.1	8.07e-110	1	272	272	546
QUO37985.1	2.22e-102	8	276	280	551
QIB69198.1	1.31e-75	9	276	282	553
QAT42616.1	2.83e-74	9	276	282	553

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CZ8_A	2.13e-17	24	261	76	308	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
4Q6T_A	8.09e-12	53	262	114	325	Thecrystal structure of a class V chitininase from Pseudomonas fluorescens Pf-5 [Pseudomonas protegens Pf-5]
4S3K_A	2.07e-09	21	262	188	413	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05495	2.77e-17	24	261	168	400	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
P37531	1.35e-10	36	262	195	409	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2
Q922Q9	6.55e-06	18	262	158	383	Chitinase domain-containing protein 1 OS=Mus musculus OX=10090 GN=Chid1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001983_02424.