CAZyme Information: MGYG000002093_01176

Basic Information

• Species: UBA5905 sp900763035
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA5905; UBA5905 sp900763035
• CAZyme ID: MGYG000002093_01176
• CAZy Family: CBM23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
603		67079.72	4.2026

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002093	1760859	MAG	Mongolia	Asia

• Gene Location: Start: 233; End: 2044 Strand: +

Full Sequence      

MERKKIILLMLCTLCLMLLLAACGGQSQGVVTPENGDLPPLDFGGQTKFQMLSSSEITDE
MKEELQSSYGLQAETIITPWEDLTVRLATLVLSDSAPDAAMFRSDGYDYPNYIVNSLVQP
VDPYLDMSHPLFSACKQYYDDTVWGDSHYLLVSGYGSSTCMFYNTKLIEDAGLESPWELY
QRNEWDWDKMREYALKLTEDSDRDGVPEVYGIAVNRPFPMLYSTGKVLGDFDGRNKTFEN
KVTDTDIARAMTLLSDLVVKDKVCPSMISGVLEMFGEGKVAMTFGEPFYTDPSVVKIAEA
GQLGICPMARDPKVDKYYVRGQVGGIWIPDGAKNPNGAVAYYAIELDHLQSDEYQEKQLK
KLQQNAHLSDGNMEQVRTIRDPEKCVPVLELAPWADPASWLMVGNASTWEVELARTLPSV
EALAEEMFKPLEVDLPLSPKTVDDFEGYGDDTAAKIAKYVALTEGSGNIQMTLDKANSQG
DGKYAAKIVYDCSDAGWGSLEHNIYKTWEGNDALRLWVKGDGTPQTVTLQFNTQNGGIWR
YDLQVSGTDGQTVTIPFSDFRIPEGGIEVDLDLTRITKLYLTFDGEQAGTHTLYLDDITA
VKQ

Enzyme Prediction     

EC	3.2.1.78

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM23	441	599	2e-31	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13585	PBP2_TMBP_like	1.28e-23	48	357	3	302	The periplasmic-binding component of ABC transport systems specific for trehalose/maltose and similar oligosaccharides; possess type 2 periplasmic binding fold. This family includes the periplasmic trehalose/maltose-binding component of an ABC transport system and related proteins from archaea and bacteria. Members of this group belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. The majority of PBP2 proteins function in the uptake of small soluble substrates in eubacteria and archaea. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.
cd14748	PBP2_UgpB	1.54e-17	56	357	14	305	The periplasmic-binding component of ABC transport system specific for sn-glycerol-3-phosphate; possesses type 2 periplasmic binding fold. This group includes the periplasmic component of an ABC transport system specific for sn-glycerol-3-phosphate (G3P) and closely related proteins from archaea and bacteria. Under phophate starvation conditions, Escherichia coli can utilize G3P as phosphate source when exclusively imported by an ATP-binding cassette (ABC) transporter composed of the periplasmic binding protein, UgpB, the transmembrane subunits, UgpA and UgpE, and a homodimer of the nucleotide binding subunit, UgpC. Members of this group belong to the type 2 periplasmic-binding fold superfamily. PBP2 proteins are comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. The majority of PBP2 proteins function in the uptake of small soluble substrates in eubacteria and archaea. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.
cd14749	PBP2_XBP1_like	1.87e-16	56	361	15	312	The periplasmic-binding component of ABC transport systems specific for xylo-oligosaccharides; possesses type 2 periplasmic binding fold. This group represents the periplasmic component of an ABC transport system XBP1 that shows preference for xylo-oligosaccharides in the order of xylotriose > xylobiose > xylotetraose. Members of this group belong to the type 2 periplasmic-binding fold superfamily. PBP2 proteins are comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. The majority of PBP2 proteins function in the uptake of small soluble substrates in eubacteria and archaea. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.
COG1653	UgpB	8.52e-16	74	361	65	346	ABC-type glycerol-3-phosphate transport system, periplasmic component [Carbohydrate transport and metabolism].
cd14751	PBP2_GacH	2.50e-14	55	364	13	305	The periplasmic-binding component of the putative oligosacchride ABC transporter GacHFG; possesses type 2 periplasmic binding fold. This group represents the periplasmic component GacH of an ABC import system. GacH is identified as a maltose/maltodextrin-binding protein with a low affinity for acarbose. Members of this group belong to the type 2 periplasmic-binding fold superfamily. PBP2 proteins are comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. The majority of PBP2 proteins function in the uptake of small soluble substrates in eubacteria and archaea. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASA19674.1	1.27e-19	436	602	831	999
QSF42801.1	6.78e-19	436	602	825	993
CAD5933091.1	2.45e-18	441	600	690	845
CAD5988319.1	2.45e-18	441	600	690	845
QGQ98362.1	1.04e-16	442	602	695	858

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1A278	7.98e-08	440	559	720	834	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000055	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	29