CAZyme Information: MGYG000002126_00050

Basic Information

• Species: UBA1390 sp900764045
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; UBA1390; UBA1390; UBA1390 sp900764045
• CAZyme ID: MGYG000002126_00050
• CAZy Family: GH142
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
697		81088.72	5.2776

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002126	2317686	MAG	Mongolia	Asia

• Gene Location: Start: 54501; End: 56594 Strand: -

Full Sequence      

MEGLHYSDRALRTHTGKLLFGPVGRRMGVDYLDRRPGFCGRIDLIHKTNLTQLFEVCCDK
DADWELASSDWYPDRLTMEYETEDFIFSEVKRALMQDLAFCVQTWTNRSDTPMKLTFQVR
PEGTEIDGGFFCTPELSYGYKVGGVSAWNYPQTERMVQPGETVEVMAACQLGNLSSETRQ
ELEDKLAEFWRECPDSASANRKADAEWQSFMEGVPSFTSSHPMLDMTWKYRWFINKHCTC
YPEYGNLQHAVMFEGRSHRMDKTPFVSKGWEFTKLIPLSTPLHVTDYRWHHDHETAHEFL
RTFFDSADENGIPRCTLTNDHTSSYANYGLWAAYQLYLLDGDKEFLKEILPAMKAYIEGH
RKVYGDSADELQIEYTHARTGKEYQPSYWYFHNYPINPKDKTTYTPLKRVDRSVYHYLNT
KGLASICRILGDADAERYEALAEKIAEDINTKMWDPQTHFYYDLHYQTDEKAMVKNIVGF
YPYWAQIASEDKLPGLEYLMDPNQFNTGNAFPSVSKENPVYSPDGGWQGNFIKGRNGCVW
CGPSWPYTTAIALSALGEESKKHEHRYDHAFWEFFRQYTNQHFRDGDIRRPYLVEHYNPE
SGERLSDEVDYNHSYWIDLIVSFVAGVEVQEERIIIDPLHLGLKWFALTDLDIRGHRYDI
SWSEGRSRGEVPAGLRICRDGEEIYRGESLGKVEVIG

Enzyme Prediction     

No EC number prediction in MGYG000002126_00050.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH142	203	691	3e-54	0.964509394572025

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	5.73e-16	410	529	578	709	alpha-glucosidase; Provisional
pfam17389	Bac_rhamnosid6H	4.77e-10	331	463	108	223	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam06202	GDE_C	2.59e-08	330	471	87	228	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
COG3408	GDB1	7.78e-06	294	575	303	562	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
COG1626	TreA	1.72e-05	357	492	304	437	Neutral trehalase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFC30936.1	4.33e-209	4	695	12	714
AFH63258.2	3.92e-208	4	695	5	707
QNK60812.1	4.05e-206	9	690	10	695
QQR38309.1	2.58e-180	4	663	8	670
CCW34533.1	3.02e-51	210	684	389	864

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6M5A_A	3.77e-10	170	690	265	806	Crystalstructure of GH121 beta-L-arabinobiosidase HypBA2 from Bifidobacterium longum [Bifidobacterium longum]
3W7S_A	1.40e-09	410	529	551	682	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7W_A	1.40e-09	410	529	551	682	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7X_A	1.40e-09	410	529	551	682	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
6XUX_A	1.51e-09	410	529	100	231	ChainA, Nanobody,Glucosidase YgjK,Glucosidase YgjK,Nanobody [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94250	1.61e-12	303	542	82	319	Uncharacterized protein BB_0381 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0381 PE=4 SV=2
E8MGH9	2.54e-09	170	690	296	837	Beta-L-arabinobiosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA2 PE=1 SV=1
P42592	7.77e-09	410	529	574	705	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002126_00050.