CAZyme Information: MGYG000002126_02082

Basic Information

• Species: UBA1390 sp900764045
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; UBA1390; UBA1390; UBA1390 sp900764045
• CAZyme ID: MGYG000002126_02082
• CAZy Family: GH140
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
495		57495.36	6.74

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002126	2317686	MAG	Mongolia	Asia

• Gene Location: Start: 1068; End: 2555 Strand: +

Full Sequence      

MVKGIVKKTDESLKGKKEFLKPLFRSLGMMYNGKRLVEKRRVKEMEKTCKKPWEYGPLAA
AKGKPYLVTGDKPFFWLGDTAWLLFHNLKKEEVEVYLRNRAEKGYNVIQATLFHFAPCEN
AYGARGFLEEDVTKPNLEGEFTYWDMVDYVVKTAEKYGLYMAMLPHWGGIVKSGWTDPEK
VKVYAAFLAERYKDAPNVIWITGGDTRGNEAFEYWNNMGSTLKKLNPDKLVCFHPFGRTT
SIDYFPNADWLDMHMFQSGHRRYDQIKLKAWDDNDQDDYSFGEDNWKYVERVHRMTAQRP
EGPMPVLDAEPSYENIPQGLHGGAEPMWRDRDVRRYAYWSVLAGACGFTYGHNAIMQMWH
TRDKAGNYDCWEKWSEAIHHPGSDSMKHLTELMNSVDFINGHPAQELLADEPGEKYERIS
VFAGPDYLLAYSYTGRKIQLKENALDGEAEVYWMNPLTGVMSYAGVTDFAEERVFVTPSK
EYMPNRDWVLVLRRK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	61	490	4.1e-132	0.9854368932038835

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13204	DUF4038	1.69e-124	66	395	4	319	Protein of unknown function (DUF4038). A family of putative cellulases.
pfam12904	Collagen_bind_2	1.77e-18	403	492	2	91	Putative collagen-binding domain of a collagenase. This domain is likely to be the collagen-binding domain of a family of bacterial collagenase enzymes. It is the C-terminal part of the Structure 3kzs (information derived from TOPSAN).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANW98439.1	3.23e-133	63	492	10	438
ANX00976.1	3.23e-133	63	492	10	438
AGC68049.1	3.23e-133	63	492	10	438
AGI39079.1	3.23e-133	63	492	10	438
QOV18626.1	3.36e-130	66	492	17	434

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	1.48e-111	52	468	12	422	Glycosidehydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
3KZS_A	4.15e-105	52	468	12	422	Crystalstructure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4QFU_A	1.05e-98	52	492	25	460	ChainA, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_B Chain B, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_C Chain C, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_D Chain D, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_E Chain E, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_F Chain F, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_G Chain G, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_H Chain H, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_I Chain I, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_J Chain J, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_K Chain K, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_L Chain L, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002126_02082.